BLASTX nr result
ID: Jatropha_contig00004763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004763 (114 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247186.1| PREDICTED: vicilin-like antimicrobial peptid... 55 9e-06 >ref|XP_004247186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum lycopersicum] Length = 469 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +1 Query: 13 HWDADGVLYVARGRGTISMIIEEKRQSFNVQRGD 114 HWDAD VL+VA+GRGT+S++ + KR SFN++RGD Sbjct: 134 HWDADAVLFVAQGRGTLSLVRKGKRNSFNIRRGD 167