BLASTX nr result
ID: Jatropha_contig00004594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004594 (311 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520854.1| 40S ribosomal protein S26, putative [Ricinus... 66 4e-09 ref|XP_002520300.1| 40S ribosomal protein S26, putative [Ricinus... 65 1e-08 ref|XP_002325921.1| predicted protein [Populus trichocarpa] gi|1... 65 1e-08 ref|XP_002534119.1| 40S ribosomal protein S26, putative [Ricinus... 62 1e-07 gb|ESR49142.1| hypothetical protein CICLE_v10033072mg [Citrus cl... 60 2e-07 gb|ESR49140.1| hypothetical protein CICLE_v10033333mg, partial [... 60 2e-07 gb|ESR49138.1| hypothetical protein CICLE_v10033939mg, partial [... 60 2e-07 ref|XP_002319327.1| predicted protein [Populus trichocarpa] gi|1... 60 2e-07 gb|EMJ19793.1| hypothetical protein PRUPE_ppa013316mg [Prunus pe... 58 1e-06 gb|EOY20153.1| 40S ribosomal protein S26-2 [Theobroma cacao] 58 1e-06 ref|XP_004502848.1| PREDICTED: 40S ribosomal protein S26-2-like ... 57 3e-06 ref|NP_001237164.1| uncharacterized protein LOC100527516 [Glycin... 57 3e-06 ref|NP_001239976.1| uncharacterized protein LOC100784958 [Glycin... 57 3e-06 ref|NP_001235570.1| uncharacterized protein LOC100305706 [Glycin... 57 3e-06 ref|NP_001237066.1| uncharacterized protein LOC100499862 [Glycin... 56 5e-06 gb|AAC77928.1| similar to ribosomal protein S26 [Medicago sativa] 55 7e-06 gb|AAD47346.1|AF112440_1 ribosomal protein S26 [Pisum sativum] g... 55 7e-06 gb|AFK45380.1| unknown [Lotus japonicus] 55 7e-06 ref|XP_003617941.1| 40S ribosomal protein [Medicago truncatula] ... 55 7e-06 ref|XP_004494348.1| PREDICTED: 40S ribosomal protein S26-2-like ... 55 9e-06 >ref|XP_002520854.1| 40S ribosomal protein S26, putative [Ricinus communis] gi|223539985|gb|EEF41563.1| 40S ribosomal protein S26, putative [Ricinus communis] Length = 132 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQTGQ 219 R+ERRNREPPQRFLRRRDDLPKPGQPGQ GQ Sbjct: 89 RSERRNREPPQRFLRRRDDLPKPGQPGQPGQ 119 >ref|XP_002520300.1| 40S ribosomal protein S26, putative [Ricinus communis] gi|223540519|gb|EEF42086.1| 40S ribosomal protein S26, putative [Ricinus communis] Length = 132 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQTGQ 219 R+ERRNREPP+RFLRRRDDLPKPGQPGQ GQ Sbjct: 89 RSERRNREPPKRFLRRRDDLPKPGQPGQPGQ 119 >ref|XP_002325921.1| predicted protein [Populus trichocarpa] gi|118481553|gb|ABK92719.1| unknown [Populus trichocarpa] gi|118482517|gb|ABK93181.1| unknown [Populus trichocarpa] gi|118483324|gb|ABK93564.1| unknown [Populus trichocarpa] gi|118484296|gb|ABK94027.1| unknown [Populus trichocarpa] gi|118484597|gb|ABK94172.1| unknown [Populus trichocarpa] gi|118489329|gb|ABK96469.1| unknown [Populus trichocarpa x Populus deltoides] gi|222862796|gb|EEF00303.1| ribosomal protein S26 [Populus trichocarpa] Length = 132 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQTGQ 219 R+ERRNREPPQRF+RRRDD+PKPGQPGQ GQ Sbjct: 89 RSERRNREPPQRFIRRRDDMPKPGQPGQPGQ 119 >ref|XP_002534119.1| 40S ribosomal protein S26, putative [Ricinus communis] gi|223525822|gb|EEF28263.1| 40S ribosomal protein S26, putative [Ricinus communis] Length = 132 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQTGQ 219 R+ERRNR+PPQRFLRRRD+ PKPGQPGQ GQ Sbjct: 89 RSERRNRQPPQRFLRRRDEAPKPGQPGQPGQ 119 >gb|ESR49142.1| hypothetical protein CICLE_v10033072mg [Citrus clementina] Length = 128 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RRNREPP+RF+RRRDDLPKPGQPGQ Sbjct: 89 RTDRRNREPPKRFMRRRDDLPKPGQPGQ 116 >gb|ESR49140.1| hypothetical protein CICLE_v10033333mg, partial [Citrus clementina] Length = 86 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RRNREPP+RF+RRRDDLPKPGQPGQ Sbjct: 47 RTDRRNREPPKRFMRRRDDLPKPGQPGQ 74 >gb|ESR49138.1| hypothetical protein CICLE_v10033939mg, partial [Citrus clementina] Length = 112 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RRNREPP+RF+RRRDDLPKPGQPGQ Sbjct: 71 RTDRRNREPPKRFMRRRDDLPKPGQPGQ 98 >ref|XP_002319327.1| predicted protein [Populus trichocarpa] gi|118485484|gb|ABK94597.1| unknown [Populus trichocarpa] gi|222857703|gb|EEE95250.1| ribosomal protein S26 [Populus trichocarpa] Length = 131 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 308 TERRNREPPQRFLRRRDDLPKPGQPGQTGQ 219 +ERR REPPQRF+RRRDD+PKPGQPGQ GQ Sbjct: 90 SERRKREPPQRFIRRRDDMPKPGQPGQPGQ 119 >gb|EMJ19793.1| hypothetical protein PRUPE_ppa013316mg [Prunus persica] Length = 129 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT RRNREPPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTNRRNREPPQRFIRRRDDAPRPGQPGQ 116 >gb|EOY20153.1| 40S ribosomal protein S26-2 [Theobroma cacao] Length = 128 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR R+PPQRF+RRRDD+PKPGQPGQ Sbjct: 89 RTDRRKRDPPQRFIRRRDDMPKPGQPGQ 116 >ref|XP_004502848.1| PREDICTED: 40S ribosomal protein S26-2-like [Cicer arietinum] Length = 130 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR REPPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKREPPQRFIRRRDDAPRPGQPGQ 116 >ref|NP_001237164.1| uncharacterized protein LOC100527516 [Glycine max] gi|255632524|gb|ACU16612.1| unknown [Glycine max] Length = 129 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR REPPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKREPPQRFIRRRDDAPRPGQPGQ 116 >ref|NP_001239976.1| uncharacterized protein LOC100784958 [Glycine max] gi|255627385|gb|ACU14037.1| unknown [Glycine max] gi|255642187|gb|ACU21358.1| unknown [Glycine max] Length = 129 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR REPPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKREPPQRFIRRRDDAPRPGQPGQ 116 >ref|NP_001235570.1| uncharacterized protein LOC100305706 [Glycine max] gi|255626367|gb|ACU13528.1| unknown [Glycine max] Length = 130 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR REPPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKREPPQRFIRRRDDAPRPGQPGQ 116 >ref|NP_001237066.1| uncharacterized protein LOC100499862 [Glycine max] gi|255627229|gb|ACU13959.1| unknown [Glycine max] Length = 130 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQTG 222 RT+RR REPPQRF+RRRDD P+PGQPG G Sbjct: 89 RTDRRKREPPQRFIRRRDDAPRPGQPGGQG 118 >gb|AAC77928.1| similar to ribosomal protein S26 [Medicago sativa] Length = 124 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR R+PPQRF+RRRDD P+PGQPGQ Sbjct: 83 RTDRRKRDPPQRFIRRRDDAPRPGQPGQ 110 >gb|AAD47346.1|AF112440_1 ribosomal protein S26 [Pisum sativum] gi|388492776|gb|AFK34454.1| unknown [Medicago truncatula] gi|388494954|gb|AFK35543.1| unknown [Medicago truncatula] Length = 130 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR R+PPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKRDPPQRFIRRRDDAPRPGQPGQ 116 >gb|AFK45380.1| unknown [Lotus japonicus] Length = 129 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR R+PPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKRDPPQRFIRRRDDAPRPGQPGQ 116 >ref|XP_003617941.1| 40S ribosomal protein [Medicago truncatula] gi|355519276|gb|AET00900.1| 40S ribosomal protein [Medicago truncatula] Length = 230 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR R+PPQRF+RRRDD P+PGQPGQ Sbjct: 189 RTDRRKRDPPQRFIRRRDDAPRPGQPGQ 216 >ref|XP_004494348.1| PREDICTED: 40S ribosomal protein S26-2-like [Cicer arietinum] Length = 130 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 311 RTERRNREPPQRFLRRRDDLPKPGQPGQ 228 RT+RR R+PPQRF+RRRDD P+PGQPGQ Sbjct: 89 RTDRRKRDPPQRFVRRRDDAPRPGQPGQ 116