BLASTX nr result
ID: Jatropha_contig00004590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004590 (375 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309194.1| predicted protein [Populus trichocarpa] 67 3e-13 gb|EEE92717.2| hypothetical protein POPTR_0006s11070g, partial [... 67 3e-13 ref|XP_004143958.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 67 3e-13 ref|XP_002265672.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 67 3e-13 ref|XP_002509917.1| ubiquitin-conjugating enzyme E2, putative [R... 67 3e-13 gb|ABK94185.1| unknown [Populus trichocarpa] gi|118484898|gb|ABK... 67 3e-13 ref|XP_004161475.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 67 3e-13 gb|EEF05443.2| hypothetical protein POPTR_0016s14580g, partial [... 65 4e-13 ref|XP_003616052.1| Ubiquitin carrier protein [Medicago truncatu... 65 4e-13 ref|XP_003538339.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 65 4e-13 ref|XP_003534632.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 65 4e-13 gb|AFK37453.1| unknown [Lotus japonicus] 65 4e-13 ref|XP_003538338.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 65 4e-13 ref|XP_003534631.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 65 4e-13 gb|ACU13977.1| unknown [Glycine max] 65 4e-13 ref|XP_002532653.1| ubiquitin-conjugating enzyme E2, putative [R... 65 4e-13 ref|NP_001235384.1| uncharacterized protein LOC100499741 [Glycin... 65 4e-13 ref|XP_002323682.1| predicted protein [Populus trichocarpa] gi|1... 65 4e-13 ref|XP_004490726.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 65 4e-13 ref|NP_001235930.1| ubiquitin-conjugation enzyme [Glycine max] g... 65 4e-13 >ref|XP_002309194.1| predicted protein [Populus trichocarpa] Length = 223 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 178 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 208 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 210 EATARSWTQKYAMG 223 >gb|EEE92717.2| hypothetical protein POPTR_0006s11070g, partial [Populus trichocarpa] Length = 220 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 175 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 205 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 207 EATARSWTQKYAMG 220 >ref|XP_004143958.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cucumis sativus] Length = 160 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 115 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 145 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 147 EATARSWTQKYAMG 160 >ref|XP_002265672.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 1 [Vitis vinifera] gi|359478871|ref|XP_003632179.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 2 [Vitis vinifera] gi|297745749|emb|CBI15805.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 133 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 135 EATARSWTQKYAMG 148 >ref|XP_002509917.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] gi|223549816|gb|EEF51304.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] gi|386278586|gb|AFJ04525.1| ubiquitin-conjugating enzyme E2 [Vernicia fordii] gi|388505170|gb|AFK40651.1| unknown [Medicago truncatula] Length = 148 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 133 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 135 EATARSWTQKYAMG 148 >gb|ABK94185.1| unknown [Populus trichocarpa] gi|118484898|gb|ABK94315.1| unknown [Populus trichocarpa] Length = 148 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 133 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 135 EATARSWTQKYAMG 148 >ref|XP_004161475.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cucumis sativus] Length = 138 Score = 66.6 bits (161), Expect(2) = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDRSK Sbjct: 93 LLSICSLLTDPNPDDPLVPEIAHMYKTDRSK 123 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 277 EATARSWTQKYAMG 236 EATARSWTQKYAMG Sbjct: 125 EATARSWTQKYAMG 138 >gb|EEF05443.2| hypothetical protein POPTR_0016s14580g, partial [Populus trichocarpa] Length = 216 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 171 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 201 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 200 AKYEATARSWTQKYAMG 216 >ref|XP_003616052.1| Ubiquitin carrier protein [Medicago truncatula] gi|355517387|gb|AES99010.1| Ubiquitin carrier protein [Medicago truncatula] Length = 207 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 162 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 192 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 191 AKYEATARSWTQKYAMG 207 >ref|XP_003538339.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform 2 [Glycine max] Length = 169 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 124 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 154 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 153 AKYEATARSWTQKYAMG 169 >ref|XP_003534632.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform 2 [Glycine max] Length = 158 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 113 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 143 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 142 AKYEATARSWTQKYAMG 158 >gb|AFK37453.1| unknown [Lotus japonicus] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|XP_003538338.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform 1 [Glycine max] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|XP_003534631.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform 1 [Glycine max] gi|502104573|ref|XP_004492582.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Cicer arietinum] gi|388506176|gb|AFK41154.1| unknown [Lotus japonicus] gi|413968378|gb|AFW90527.1| ubiquitin-conjugating enzyme E2 28-like isoform 1 [Phaseolus vulgaris] gi|558695667|gb|AHA84187.1| ubiquitin-conjugating enzyme E2 28-like isoform 1 [Phaseolus vulgaris] gi|561013189|gb|ESW12050.1| hypothetical protein PHAVU_008G080800g [Phaseolus vulgaris] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >gb|ACU13977.1| unknown [Glycine max] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|XP_002532653.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] gi|223527613|gb|EEF29726.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|NP_001235384.1| uncharacterized protein LOC100499741 [Glycine max] gi|224145412|ref|XP_002325633.1| predicted protein [Populus trichocarpa] gi|356500952|ref|XP_003519294.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Glycine max] gi|118488177|gb|ABK95908.1| unknown [Populus trichocarpa] gi|222862508|gb|EEF00015.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|255626223|gb|ACU13456.1| unknown [Glycine max] gi|388494512|gb|AFK35322.1| unknown [Lotus japonicus] gi|388500372|gb|AFK38252.1| unknown [Lotus japonicus] gi|462401739|gb|EMJ07296.1| hypothetical protein PRUPE_ppa012944mg [Prunus persica] gi|462401740|gb|EMJ07297.1| hypothetical protein PRUPE_ppa012944mg [Prunus persica] gi|550317613|gb|ERP49477.1| hypothetical protein POPTR_0019s15200g [Populus trichocarpa] gi|550317614|gb|ERP49478.1| hypothetical protein POPTR_0019s15200g [Populus trichocarpa] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|XP_002323682.1| predicted protein [Populus trichocarpa] gi|118482563|gb|ABK93202.1| unknown [Populus trichocarpa] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|XP_004490726.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Cicer arietinum] gi|115187616|gb|ABI84263.1| ubiquitin carrier-like protein [Arachis hypogaea] gi|388513553|gb|AFK44838.1| unknown [Medicago truncatula] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148 >ref|NP_001235930.1| ubiquitin-conjugation enzyme [Glycine max] gi|22597164|gb|AAN03469.1| ubiquitin-conjugation enzyme [Glycine max] Length = 148 Score = 65.5 bits (158), Expect(2) = 4e-13 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 374 LLSICSLLSDPNPDDPLVPEIAHMYKTDRSK 282 LLSICSLL+DPNPDDPLVPEIAHMYKTDR+K Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAK 133 Score = 34.3 bits (77), Expect(2) = 4e-13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 286 ANSEATARSWTQKYAMG 236 A EATARSWTQKYAMG Sbjct: 132 AKYEATARSWTQKYAMG 148