BLASTX nr result
ID: Jatropha_contig00004588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004588 (399 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528631.1| late embryogenesis abundant, putative [Ricin... 70 3e-10 >ref|XP_002528631.1| late embryogenesis abundant, putative [Ricinus communis] gi|223531920|gb|EEF33734.1| late embryogenesis abundant, putative [Ricinus communis] Length = 406 Score = 70.1 bits (170), Expect = 3e-10 Identities = 50/129 (38%), Positives = 54/129 (41%), Gaps = 2/129 (1%) Frame = +1 Query: 16 EKAIETKDYTXXXXXXXXXXXXXXXXXLAESAKGAARKAMDLFGXXXXXXXXXXXXXXXX 195 EKA E KDYT L ESAKGAAR+AMDLF Sbjct: 205 EKAKEAKDYTAEKAKEGKDTATSRLGELTESAKGAARRAMDLFSTKKEEAKDKTVETKEA 264 Query: 196 XXXXXXXXXXXXXXXXXXXXXXXXXXQKD--IEAERGSAARDNIFEKAGLGSIKDSIKGK 369 KD IEAERG+ ARD IF AGLGSIK+SIKGK Sbjct: 265 GKEKLSEAEEEARRKMEELKMEGEEYNKDKDIEAERGTRARDTIFGNAGLGSIKESIKGK 324 Query: 370 LTMPRTLGN 396 L P + N Sbjct: 325 LQQPHDVVN 333