BLASTX nr result
ID: Jatropha_contig00004530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004530 (384 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321121.1| predicted protein [Populus trichocarpa] gi|2... 64 3e-08 ref|XP_002524169.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 gb|EMJ17176.1| hypothetical protein PRUPE_ppa011622mg [Prunus pe... 58 1e-06 ref|XP_002301629.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 gb|ESR60776.1| hypothetical protein CICLE_v10018295mg, partial [... 57 2e-06 >ref|XP_002321121.1| predicted protein [Populus trichocarpa] gi|222861894|gb|EEE99436.1| hypothetical protein POPTR_0014s15000g [Populus trichocarpa] Length = 162 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +2 Query: 197 EESGWTAYFEDFSNHREEEGEEDSFCNAGF*GSTSMVSDAASYPAWK 337 EESGWT+YFEDFSNH+E E+ S C+ F S+SMVSDAAS+P WK Sbjct: 21 EESGWTSYFEDFSNHKE---EDHSLCSITF-DSSSMVSDAASFPPWK 63 >ref|XP_002524169.1| conserved hypothetical protein [Ricinus communis] gi|223536538|gb|EEF38184.1| conserved hypothetical protein [Ricinus communis] Length = 198 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +2 Query: 194 EEESGWTAYFEDFSNHREEEGEE-DSFCNAGF*GSTSMVSDAASYPAW 334 +EESGWTAYFEDFSN R ++ ++ DSF G++SMVSDAAS PAW Sbjct: 28 DEESGWTAYFEDFSNQRRDDDDDGDSF------GTSSMVSDAASIPAW 69 >gb|EMJ17176.1| hypothetical protein PRUPE_ppa011622mg [Prunus persica] Length = 203 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 6/55 (10%) Frame = +2 Query: 191 TEEESGWTAYFEDFSNHR------EEEGEEDSFCNAGF*GSTSMVSDAASYPAWK 337 TEEESGWTAYFEDFSN+ E EE S C++ F ++S+VSDAAS AWK Sbjct: 23 TEEESGWTAYFEDFSNNNNNNREGEAAAEEQSLCSS-FGCTSSLVSDAASGAAWK 76 >ref|XP_002301629.1| predicted protein [Populus trichocarpa] gi|222843355|gb|EEE80902.1| hypothetical protein POPTR_0002s23090g [Populus trichocarpa] Length = 192 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +2 Query: 197 EESGWTAYFEDFSNHREEEGEEDSFCNAGF*GSTSMVSDAASYPAWK 337 EESGWT+YFED SNH+E E S C++ S+SMVSDAAS+P WK Sbjct: 27 EESGWTSYFEDLSNHKE---EGQSLCSSF--DSSSMVSDAASFPPWK 68 >gb|ESR60776.1| hypothetical protein CICLE_v10018295mg, partial [Citrus clementina] Length = 206 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +2 Query: 194 EEESGWTAYFEDFSNHREEEGEEDSFCNAGF*GSTSMVSDAASYPAWK 337 EEESGWTAYFEDFSN EE S+C++ GS S+VSDAAS AWK Sbjct: 44 EEESGWTAYFEDFSNDNINR-EEYSYCSSF--GSPSLVSDAASCAAWK 88