BLASTX nr result
ID: Jatropha_contig00004450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004450 (450 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAA51556.1| hypothetical protein CLF_106372 [Clonorchis sine... 65 1e-08 >dbj|GAA51556.1| hypothetical protein CLF_106372 [Clonorchis sinensis] Length = 212 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 293 MSYRGAYFGPPVLFGYRRGANLLRRRFANTYE 388 M+YRGAYFGPP++FGYRRGANLLRRRFA YE Sbjct: 1 MNYRGAYFGPPIIFGYRRGANLLRRRFATAYE 32