BLASTX nr result
ID: Jatropha_contig00004297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004297 (376 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 92 5e-17 gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus... 91 1e-16 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 87 2e-15 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 82 7e-14 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 79 4e-13 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 79 8e-13 ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843... 77 2e-12 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 8e-12 ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840... 72 9e-11 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 92.4 bits (228), Expect = 5e-17 Identities = 44/60 (73%), Positives = 53/60 (88%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKRASP 138 M+IFGK V P QI+L ASG++FLASTTYDVHRSIKNNETPPS+EQ++ALE+YI+S R P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRQP 60 >gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKRAS 141 M+IFGK+V P QI+L ASG++F ASTTYDVHRSIKNN+TPPS+EQ++AL+DYI S R S Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARRS 59 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/57 (68%), Positives = 50/57 (87%) Frame = -3 Query: 320 AMKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSK 150 +M++FGK+V P QI+L A+G+VF +TTYDVHRSIKNNE PP++EQMEAL+DYI SK Sbjct: 686 SMRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSK 742 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKR 147 MKIFGK +S QI + ++GV+F A+TTYDVHRSIKNNE PPS EQ++ALEDYI S R Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVR 57 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/57 (61%), Positives = 47/57 (82%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKR 147 M++ GK+VS Q+ L A+G+VF +TTYDVHRSIKNN+ PP++EQMEAL+ YI SK+ Sbjct: 1 MRLLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKK 57 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/57 (57%), Positives = 49/57 (85%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKR 147 M++ G++VSP QI L+A+G+VF +TTYDVHRSIKNN+ PP++EQ+ AL+D+I S++ Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRK 57 >ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 83 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/65 (55%), Positives = 50/65 (76%), Gaps = 5/65 (7%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDY-----IRS 153 M+ GK+VSP Q+ L A+G+VF +TTYDVHRSIKNN+ PP++EQMEAL+ Y +R+ Sbjct: 1 MRPLGKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVYTTPRSVRT 60 Query: 152 KRASP 138 R++P Sbjct: 61 NRSAP 65 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 75.1 bits (183), Expect = 8e-12 Identities = 32/57 (56%), Positives = 48/57 (84%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKR 147 M++ G++VSP QI+L+A+G+VF +TTYDVHRSIKNN+ PP+ EQ+ AL+ +I S++ Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRK 57 >ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840032 [Brachypodium distachyon] Length = 58 Score = 71.6 bits (174), Expect = 9e-11 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = -3 Query: 317 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKR 147 M+ K+VSP Q+ L A+G++ TTYDVHRSIKNN+ P ++EQMEAL++YI SK+ Sbjct: 1 MRPLDKHVSPRQVALFAAGLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDSKK 57