BLASTX nr result
ID: Jatropha_contig00004027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004027 (405 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatrop... 74 2e-11 ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [... 70 4e-10 gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] 67 2e-09 gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Maniho... 66 5e-09 gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Maniho... 66 5e-09 gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus cl... 63 3e-08 gb|ABL67651.1| putative auxin-repressed/dormancy-associated prot... 63 3e-08 ref|NP_565772.1| dormancy/auxin associated protein [Arabidopsis ... 63 3e-08 ref|NP_850220.1| dormancy/auxin associated protein [Arabidopsis ... 63 3e-08 ref|XP_006343230.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 62 1e-07 ref|XP_006343229.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 62 1e-07 ref|XP_006295284.1| hypothetical protein CARUB_v10024372mg [Caps... 62 1e-07 ref|XP_004234112.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 62 1e-07 gb|AFW90622.1| auxin-repressed protein [Solanum tuberosum] 62 1e-07 dbj|BAG50402.1| dormancy and auxin associated protein [Cardamine... 62 1e-07 gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] 61 1e-07 gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] 61 2e-07 gb|ERN19723.1| hypothetical protein AMTR_s00062p00206330 [Ambore... 60 2e-07 gb|AAO32054.1| auxin-repressed protein [Brassica rapa subsp. pek... 60 2e-07 gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] 60 2e-07 >gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatropha curcas] Length = 120 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR Sbjct: 88 KGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 120 >ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] gi|223549345|gb|EEF50833.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] Length = 118 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+GAQLFDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 86 RGIGAQLFDKPSQPNSPTVYDWLYSGETRSKHR 118 >gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] Length = 120 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GLG ++FDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 88 RGLGTEMFDKPSQPNSPTVYDWLYSGETRSKHR 120 >gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Manihot esculenta] Length = 68 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GLGAQLFDKPQ PNSPTVYDWLYSG+TRSKHR Sbjct: 37 KGLGAQLFDKPQ-PNSPTVYDWLYSGETRSKHR 68 >gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Manihot esculenta] Length = 117 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GLGAQLFDKPQ PNSPTVYDWLYSG+TRSKHR Sbjct: 86 KGLGAQLFDKPQ-PNSPTVYDWLYSGETRSKHR 117 >gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus clementina] Length = 122 Score = 63.2 bits (152), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 112 +G+GA++FDKP PNSPTVYDWLYSG+TRSKH Sbjct: 89 RGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 >gb|ABL67651.1| putative auxin-repressed/dormancy-associated protein [Citrus hybrid cultivar] Length = 122 Score = 63.2 bits (152), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 112 +G+GA++FDKP PNSPTVYDWLYSG+TRSKH Sbjct: 89 RGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 >ref|NP_565772.1| dormancy/auxin associated protein [Arabidopsis thaliana] gi|20198309|gb|AAC69134.2| putative auxin-regulated protein [Arabidopsis thaliana] gi|21553815|gb|AAM62908.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330253797|gb|AEC08891.1| dormancy/auxin associated protein [Arabidopsis thaliana] Length = 106 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+G LFDKP PNSPTVYDWLYS DTRSKHR Sbjct: 74 RGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR 106 >ref|NP_850220.1| dormancy/auxin associated protein [Arabidopsis thaliana] gi|13605730|gb|AAK32858.1|AF361846_1 At2g33830/T1B8.13 [Arabidopsis thaliana] gi|11127601|dbj|BAB17679.1| Dormancy-associated protein homolog [Arabidopsis thaliana] gi|17978893|gb|AAL47416.1| At2g33830/T1B8.13 [Arabidopsis thaliana] gi|330253798|gb|AEC08892.1| dormancy/auxin associated protein [Arabidopsis thaliana] Length = 108 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+G LFDKP PNSPTVYDWLYS DTRSKHR Sbjct: 76 RGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR 108 >ref|XP_006343230.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Solanum tuberosum] Length = 123 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 23 LGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 93 IGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 123 >ref|XP_006343229.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Solanum tuberosum] Length = 129 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 23 LGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 99 IGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 129 >ref|XP_006295284.1| hypothetical protein CARUB_v10024372mg [Capsella rubella] gi|482563992|gb|EOA28182.1| hypothetical protein CARUB_v10024372mg [Capsella rubella] Length = 108 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+G LFDKP PNSPTVYDWLYS DTRS+HR Sbjct: 76 RGMGTNLFDKPSHPNSPTVYDWLYSDDTRSQHR 108 >ref|XP_004234112.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Solanum lycopersicum] Length = 130 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 23 LGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 100 IGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 130 >gb|AFW90622.1| auxin-repressed protein [Solanum tuberosum] Length = 127 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 23 LGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 97 IGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 127 >dbj|BAG50402.1| dormancy and auxin associated protein [Cardamine sp. SIM-2007] Length = 57 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+G LFDKP PNSPT YDWLYS DTRSKHR Sbjct: 25 RGMGTNLFDKPSHPNSPTTYDWLYSDDTRSKHR 57 >gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GLG+ LFDKP+ PNSPTVYDWLYSG+TRSKHR Sbjct: 88 KGLGSALFDKPE-PNSPTVYDWLYSGETRSKHR 119 >gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] Length = 118 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+G+ +FDKPQ PNSPTVYDWLYSG+TRSKHR Sbjct: 87 KGIGSDVFDKPQ-PNSPTVYDWLYSGETRSKHR 118 >gb|ERN19723.1| hypothetical protein AMTR_s00062p00206330 [Amborella trichopoda] Length = 120 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 23 LGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +GA++FDKPQ PNSPTVYDWLYSGDTRS+HR Sbjct: 91 IGAEVFDKPQ-PNSPTVYDWLYSGDTRSRHR 120 >gb|AAO32054.1| auxin-repressed protein [Brassica rapa subsp. pekinensis] Length = 106 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 +G+G LFDKP PN+PTVYDWLYS DTRS+HR Sbjct: 74 RGMGTNLFDKPSHPNAPTVYDWLYSDDTRSQHR 106 >gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] Length = 126 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 17 QGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 112 +G+G+ +FDKPQ PNSPTVYDWLYSGDTRSKH Sbjct: 94 RGIGSNVFDKPQ-PNSPTVYDWLYSGDTRSKH 124