BLASTX nr result
ID: Jatropha_contig00004015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004015 (373 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526963.1| PREDICTED: elongation factor 1-delta-like [G... 104 1e-20 ref|NP_001237305.1| uncharacterized protein LOC100499878 [Glycin... 104 1e-20 dbj|BAJ22388.1| elongation factor 1 beta [Vigna unguiculata] 104 1e-20 gb|ADR70877.1| eukaryotic translation elongation factor 1B alpha... 102 5e-20 gb|ESR59605.1| hypothetical protein CICLE_v10016592mg [Citrus cl... 102 5e-20 gb|ESW18181.1| hypothetical protein PHAVU_006G019800g [Phaseolus... 102 6e-20 ref|NP_001060543.1| Os07g0662500 [Oryza sativa Japonica Group] g... 102 6e-20 gb|AFJ04515.1| elongation factor 1-beta [Vernicia fordii] 102 6e-20 gb|EOY22457.1| Translation elongation factor EF1B/ribosomal prot... 101 8e-20 ref|XP_002511200.1| elongation factor 1-beta, putative [Ricinus ... 101 8e-20 gb|ESW09920.1| hypothetical protein PHAVU_009G167000g [Phaseolus... 101 1e-19 ref|XP_004958599.1| PREDICTED: elongation factor 1-beta-like iso... 101 1e-19 ref|XP_004958598.1| PREDICTED: elongation factor 1-beta-like iso... 101 1e-19 ref|XP_002523210.1| elongation factor 1-beta, putative [Ricinus ... 101 1e-19 gb|ESR60099.1| hypothetical protein CICLE_v10018101mg, partial [... 100 1e-19 gb|ESR41260.1| hypothetical protein CICLE_v10027451mg, partial [... 100 1e-19 ref|XP_002314248.1| predicted protein [Populus trichocarpa] gi|1... 100 1e-19 ref|XP_004152523.1| PREDICTED: elongation factor 1-delta-like [C... 100 2e-19 ref|XP_004138389.1| PREDICTED: elongation factor 1-delta-like [C... 100 2e-19 ref|NP_001238069.1| uncharacterized protein LOC100306132 [Glycin... 100 2e-19 >ref|XP_003526963.1| PREDICTED: elongation factor 1-delta-like [Glycine max] Length = 230 Score = 104 bits (260), Expect = 1e-20 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+LIEEHLTVEP+NEYVQSCDIVAFNKI Sbjct: 178 KLVPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLTVEPINEYVQSCDIVAFNKI 230 >ref|NP_001237305.1| uncharacterized protein LOC100499878 [Glycine max] gi|255627339|gb|ACU14014.1| unknown [Glycine max] Length = 230 Score = 104 bits (260), Expect = 1e-20 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+LIEEHLTVEP+NEYVQSCDIVAFNKI Sbjct: 178 KLVPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLTVEPINEYVQSCDIVAFNKI 230 >dbj|BAJ22388.1| elongation factor 1 beta [Vigna unguiculata] Length = 230 Score = 104 bits (259), Expect = 1e-20 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQ+MLTIVDDLVSVD+LIEEHLTVEP+NEYVQSCDIVAFNKI Sbjct: 178 KLVPVGYGIKKLQVMLTIVDDLVSVDTLIEEHLTVEPINEYVQSCDIVAFNKI 230 >gb|ADR70877.1| eukaryotic translation elongation factor 1B alpha-subunit [Hevea brasiliensis] gi|313585346|gb|ADR70878.1| eukaryotic translation elongation factor 1B alpha-subunit [Hevea brasiliensis] Length = 218 Score = 102 bits (254), Expect = 5e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEP NE+VQSCDIVAFNKI Sbjct: 166 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPCNEHVQSCDIVAFNKI 218 >gb|ESR59605.1| hypothetical protein CICLE_v10016592mg [Citrus clementina] Length = 224 Score = 102 bits (254), Expect = 5e-20 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKK+QIM+TI+DDLVSVDSLIEEHLTVEP NEYVQSCDIVAFNKI Sbjct: 172 KLVPVGYGIKKMQIMMTIIDDLVSVDSLIEEHLTVEPCNEYVQSCDIVAFNKI 224 >gb|ESW18181.1| hypothetical protein PHAVU_006G019800g [Phaseolus vulgaris] Length = 223 Score = 102 bits (253), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEE LTVEP+NEYVQSCDIVAFNKI Sbjct: 171 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEETLTVEPINEYVQSCDIVAFNKI 223 >ref|NP_001060543.1| Os07g0662500 [Oryza sativa Japonica Group] gi|90110019|sp|P29545.3|EF1B_ORYSJ RecName: Full=Elongation factor 1-beta; Short=EF-1-beta; AltName: Full=Elongation factor 1-beta'; Short=EF-1-beta'; AltName: Full=Elongation factor 1B-alpha 2; AltName: Full=eEF-1B alpha 2 gi|38175744|dbj|BAC22427.2| putative translation elongation factor eEF-1 beta' chain [Oryza sativa Japonica Group] gi|113612079|dbj|BAF22457.1| Os07g0662500 [Oryza sativa Japonica Group] gi|125559496|gb|EAZ05032.1| hypothetical protein OsI_27215 [Oryza sativa Indica Group] gi|149391281|gb|ABR25658.1| elongation factor beta-1 [Oryza sativa Indica Group] gi|215692676|dbj|BAG88096.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704364|dbj|BAG93798.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768499|dbj|BAH00728.1| unnamed protein product [Oryza sativa Japonica Group] Length = 224 Score = 102 bits (253), Expect = 6e-20 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLT EP+NE+VQSCDIVAFNKI Sbjct: 172 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTEEPINEFVQSCDIVAFNKI 224 >gb|AFJ04515.1| elongation factor 1-beta [Vernicia fordii] Length = 225 Score = 102 bits (253), Expect = 6e-20 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKL IMLTIVDDLVSVDSLIEEHLTVEP NEYVQSCDIVAFNKI Sbjct: 173 KLVPVGYGIKKLTIMLTIVDDLVSVDSLIEEHLTVEPCNEYVQSCDIVAFNKI 225 >gb|EOY22457.1| Translation elongation factor EF1B/ribosomal protein S6 family protein isoform 1 [Theobroma cacao] gi|508775202|gb|EOY22458.1| Translation elongation factor EF1B/ribosomal protein S6 family protein isoform 1 [Theobroma cacao] Length = 231 Score = 101 bits (252), Expect = 8e-20 Identities = 50/53 (94%), Positives = 50/53 (94%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD LIEEHLT EP NEYVQSCDIVAFNKI Sbjct: 179 KLVPVGYGIKKLQIMLTIVDDLVSVDDLIEEHLTTEPTNEYVQSCDIVAFNKI 231 >ref|XP_002511200.1| elongation factor 1-beta, putative [Ricinus communis] gi|223550315|gb|EEF51802.1| elongation factor 1-beta, putative [Ricinus communis] Length = 232 Score = 101 bits (252), Expect = 8e-20 Identities = 48/53 (90%), Positives = 53/53 (100%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIM+T+VDDLVSVD+LIEEHLTVEP+NE+VQSCDIVAFNKI Sbjct: 180 KLVPVGYGIKKLQIMMTVVDDLVSVDNLIEEHLTVEPINEHVQSCDIVAFNKI 232 >gb|ESW09920.1| hypothetical protein PHAVU_009G167000g [Phaseolus vulgaris] Length = 230 Score = 101 bits (251), Expect = 1e-19 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEE LTVEP+NEYVQSCDI AFNKI Sbjct: 178 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEERLTVEPINEYVQSCDIAAFNKI 230 >ref|XP_004958599.1| PREDICTED: elongation factor 1-beta-like isoform X2 [Setaria italica] Length = 220 Score = 101 bits (251), Expect = 1e-19 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKK+ +MLTIVDDLVSVDSLIE+HLTVEP+NEYVQSCDIVAFNKI Sbjct: 168 KLVPVGYGIKKMTVMLTIVDDLVSVDSLIEDHLTVEPINEYVQSCDIVAFNKI 220 >ref|XP_004958598.1| PREDICTED: elongation factor 1-beta-like isoform X1 [Setaria italica] Length = 223 Score = 101 bits (251), Expect = 1e-19 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKK+ +MLTIVDDLVSVDSLIE+HLTVEP+NEYVQSCDIVAFNKI Sbjct: 171 KLVPVGYGIKKMTVMLTIVDDLVSVDSLIEDHLTVEPINEYVQSCDIVAFNKI 223 >ref|XP_002523210.1| elongation factor 1-beta, putative [Ricinus communis] gi|223537506|gb|EEF39131.1| elongation factor 1-beta, putative [Ricinus communis] Length = 226 Score = 101 bits (251), Expect = 1e-19 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIM+TIVDDLVSVDSLIEE+LTVEP NEYVQSCDIVAFNKI Sbjct: 174 KLVPVGYGIKKLQIMMTIVDDLVSVDSLIEEYLTVEPYNEYVQSCDIVAFNKI 226 >gb|ESR60099.1| hypothetical protein CICLE_v10018101mg, partial [Citrus clementina] Length = 258 Score = 100 bits (250), Expect = 1e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+LIEEHL EP+NEYVQSCDIVAFNKI Sbjct: 184 KLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEHLMAEPINEYVQSCDIVAFNKI 236 >gb|ESR41260.1| hypothetical protein CICLE_v10027451mg, partial [Citrus clementina] Length = 230 Score = 100 bits (250), Expect = 1e-19 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+LIEEHL EP+NEYVQSCDIVAFNKI Sbjct: 178 KLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEHLMAEPINEYVQSCDIVAFNKI 230 >ref|XP_002314248.1| predicted protein [Populus trichocarpa] gi|118481035|gb|ABK92471.1| unknown [Populus trichocarpa] gi|118486898|gb|ABK95283.1| unknown [Populus trichocarpa] gi|222850656|gb|EEE88203.1| elongation factor 1B alpha-subunit 2 family protein [Populus trichocarpa] Length = 225 Score = 100 bits (250), Expect = 1e-19 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEE LTVEP NEY+QSCDIVAFNKI Sbjct: 173 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEERLTVEPCNEYIQSCDIVAFNKI 225 >ref|XP_004152523.1| PREDICTED: elongation factor 1-delta-like [Cucumis sativus] gi|449503686|ref|XP_004162126.1| PREDICTED: elongation factor 1-delta-like [Cucumis sativus] Length = 226 Score = 100 bits (249), Expect = 2e-19 Identities = 49/53 (92%), Positives = 53/53 (100%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+LIEE+LTVEP+NE+VQSCDIVAFNKI Sbjct: 174 KLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEYLTVEPINEHVQSCDIVAFNKI 226 >ref|XP_004138389.1| PREDICTED: elongation factor 1-delta-like [Cucumis sativus] gi|449526197|ref|XP_004170100.1| PREDICTED: elongation factor 1-delta-like [Cucumis sativus] Length = 223 Score = 100 bits (249), Expect = 2e-19 Identities = 49/53 (92%), Positives = 53/53 (100%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+LIEE+LTVEP+NE+VQSCDIVAFNKI Sbjct: 171 KLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEYLTVEPINEHVQSCDIVAFNKI 223 >ref|NP_001238069.1| uncharacterized protein LOC100306132 [Glycine max] gi|255627641|gb|ACU14165.1| unknown [Glycine max] Length = 224 Score = 100 bits (249), Expect = 2e-19 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +1 Query: 22 KLVPVGYGIKKLQIMLTIVDDLVSVDSLIEEHLTVEPVNEYVQSCDIVAFNKI 180 KLVPVGYGIKKLQIMLTIVDDLVSVD+L+EE LTVEP+NEYVQSCDIVAFNKI Sbjct: 172 KLVPVGYGIKKLQIMLTIVDDLVSVDTLVEETLTVEPINEYVQSCDIVAFNKI 224