BLASTX nr result
ID: Jatropha_contig00003960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00003960 (356 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESQ55668.1| hypothetical protein EUTSA_v10026152mg [Eutrema s... 89 6e-16 gb|ESQ39869.1| hypothetical protein EUTSA_v10001011mg [Eutrema s... 89 6e-16 ref|XP_006284481.1| hypothetical protein CARUB_v10005667mg [Caps... 89 6e-16 ref|XP_006281041.1| hypothetical protein CARUB_v10027056mg [Caps... 89 6e-16 gb|ABD65070.1| plastid ribosomal protein L19, putative [Brassica... 89 6e-16 ref|XP_002870097.1| ribosomal protein L19 family protein [Arabid... 89 6e-16 ref|XP_002863352.1| hypothetical protein ARALYDRAFT_494259 [Arab... 89 6e-16 gb|ACF23041.1| ST10 [Eutrema halophilum] 89 6e-16 gb|AAM64533.1| contains similarity to plastid ribosomal protein ... 89 6e-16 ref|NP_568677.1| 50S ribosomal protein L19-2 [Arabidopsis thalia... 89 6e-16 ref|NP_567531.1| 50S ribosomal protein L19-1 [Arabidopsis thalia... 89 6e-16 dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] 89 6e-16 gb|ESR53431.1| hypothetical protein CICLE_v10021998mg [Citrus cl... 88 1e-15 gb|ABD64915.1| plastid ribosomal protein L19, putative [Brassica... 88 1e-15 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloro... 87 2e-15 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 87 2e-15 sp|P82413.2|RK19_SPIOL RecName: Full=50S ribosomal protein L19, ... 87 3e-15 ref|XP_002326473.1| predicted protein [Populus trichocarpa] gi|1... 86 4e-15 ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 86 5e-15 ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19, chloro... 86 5e-15 >gb|ESQ55668.1| hypothetical protein EUTSA_v10026152mg [Eutrema salsugineum] Length = 229 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 183 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >gb|ESQ39869.1| hypothetical protein EUTSA_v10001011mg [Eutrema salsugineum] Length = 226 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 180 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 226 >ref|XP_006284481.1| hypothetical protein CARUB_v10005667mg [Capsella rubella] gi|482553186|gb|EOA17379.1| hypothetical protein CARUB_v10005667mg [Capsella rubella] Length = 227 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 181 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 227 >ref|XP_006281041.1| hypothetical protein CARUB_v10027056mg [Capsella rubella] gi|482549745|gb|EOA13939.1| hypothetical protein CARUB_v10027056mg [Capsella rubella] Length = 230 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 184 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 230 >gb|ABD65070.1| plastid ribosomal protein L19, putative [Brassica oleracea] Length = 224 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 178 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 224 >ref|XP_002870097.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] gi|297315933|gb|EFH46356.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] Length = 225 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 179 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 225 >ref|XP_002863352.1| hypothetical protein ARALYDRAFT_494259 [Arabidopsis lyrata subsp. lyrata] gi|297309187|gb|EFH39611.1| hypothetical protein ARALYDRAFT_494259 [Arabidopsis lyrata subsp. lyrata] Length = 222 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 176 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 222 >gb|ACF23041.1| ST10 [Eutrema halophilum] Length = 136 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 90 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 136 >gb|AAM64533.1| contains similarity to plastid ribosomal protein L19 [Arabidopsis thaliana] Length = 229 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 183 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|NP_568677.1| 50S ribosomal protein L19-2 [Arabidopsis thaliana] gi|75247671|sp|Q8RXX5.1|RK192_ARATH RecName: Full=50S ribosomal protein L19-2, chloroplastic; Flags: Precursor gi|19347900|gb|AAL85972.1| unknown protein [Arabidopsis thaliana] gi|21436235|gb|AAM51256.1| unknown protein [Arabidopsis thaliana] gi|332008099|gb|AED95482.1| 50S ribosomal protein L19-2 [Arabidopsis thaliana] Length = 229 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 183 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|NP_567531.1| 50S ribosomal protein L19-1 [Arabidopsis thaliana] gi|75248729|sp|Q8W463.1|RK191_ARATH RecName: Full=50S ribosomal protein L19-1, chloroplastic; Flags: Precursor gi|17065490|gb|AAL32899.1| Unknown protein [Arabidopsis thaliana] gi|20148593|gb|AAM10187.1| unknown protein [Arabidopsis thaliana] gi|21554252|gb|AAM63327.1| contains similarity to plastid ribosomal protein L19 [Arabidopsis thaliana] gi|332658510|gb|AEE83910.1| 50S ribosomal protein L19-1 [Arabidopsis thaliana] Length = 225 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 179 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 225 >dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] Length = 286 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFPIYSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 240 IAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 286 >gb|ESR53431.1| hypothetical protein CICLE_v10021998mg [Citrus clementina] Length = 236 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFP+YSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 190 IAGIGVEIVFPLYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 236 >gb|ABD64915.1| plastid ribosomal protein L19, putative [Brassica oleracea] Length = 214 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFP+YSPNIKEIKVVSHRKVRRARL YLRDKLPRLSTFK Sbjct: 168 IAGIGVEIVFPLYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 214 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAG+G E VFP+YSPNIKEIKVV+HRKVRRARL YLRDKLPRLSTFK Sbjct: 185 IAGVGVEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAG+G E VFP+YSPNIKEIKVV+HRKVRRARL YLRDKLPRLSTFK Sbjct: 185 IAGVGVEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >sp|P82413.2|RK19_SPIOL RecName: Full=50S ribosomal protein L19, chloroplastic; AltName: Full=CL19; Flags: Precursor gi|189096140|pdb|3BBO|R Chain R, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7582403|gb|AAF64312.1|AF250384_1 plastid ribosomal protein L19 precursor [Spinacia oleracea] Length = 233 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAG+G E VFP+YSPNIKEIKVVSHRKVR+ARL YLRDKLPRLSTFK Sbjct: 187 IAGVGVEIVFPLYSPNIKEIKVVSHRKVRKARLYYLRDKLPRLSTFK 233 >ref|XP_002326473.1| predicted protein [Populus trichocarpa] gi|118483873|gb|ABK93827.1| unknown [Populus trichocarpa] gi|550347317|gb|ERP65527.1| ribosomal protein L19 [Populus trichocarpa] Length = 241 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAGIG E VFP+YSPNIKEIKV+ HRKVRRARL YLRDKLPRLSTFK Sbjct: 195 IAGIGVEIVFPLYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 241 >ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Solanum tuberosum] Length = 222 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAG+G E VFP+YSPNIKE+KVV HRKVRRARL YLRDKLPRLSTFK Sbjct: 176 IAGVGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 222 >ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Solanum lycopersicum] Length = 214 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 338 IAGIGFEFVFPIYSPNIKEIKVVSHRKVRRARLXYLRDKLPRLSTFK 198 IAG+G E VFP+YSPNIKE+KVV HRKVRRARL YLRDKLPRLSTFK Sbjct: 168 IAGVGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 214