BLASTX nr result
ID: Jatropha_contig00003923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00003923 (391 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518211.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 >ref|XP_002518211.1| conserved hypothetical protein [Ricinus communis] gi|223542807|gb|EEF44344.1| conserved hypothetical protein [Ricinus communis] Length = 159 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/47 (68%), Positives = 34/47 (72%) Frame = -1 Query: 376 EAFMIIXXXXXXXXXXXLHAGVFSSRYGSGYRDTEYAVGAGGEPIPK 236 EAFMII LHAGVFSSRYG GYRDT+Y VGAGGEP+PK Sbjct: 103 EAFMIILAFTQLLYVLLLHAGVFSSRYGPGYRDTDYGVGAGGEPMPK 149