BLASTX nr result
ID: Jatropha_contig00003438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00003438 (372 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520752.1| rac-GTP binding protein, putative [Ricinus c... 59 8e-07 >ref|XP_002520752.1| rac-GTP binding protein, putative [Ricinus communis] gi|223540137|gb|EEF41714.1| rac-GTP binding protein, putative [Ricinus communis] Length = 644 Score = 58.5 bits (140), Expect = 8e-07 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = -1 Query: 372 NIPETEAGRKRKYFRQLFSHSLLFMSXXXXXXXXXXXXFRAYTARKNSS 226 NIPETE+GR+RK FRQL +HSL+FMS FRAY+ARKNSS Sbjct: 595 NIPETESGRRRKVFRQLVNHSLIFMSVGAGLAVVGLAAFRAYSARKNSS 643