BLASTX nr result
ID: Jatropha_contig00003346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00003346 (523 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515261.1| carboxypeptidase regulatory region-containin... 57 2e-06 gb|ESR57771.1| hypothetical protein CICLE_v10018561mg [Citrus cl... 55 9e-06 ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera... 55 9e-06 >ref|XP_002515261.1| carboxypeptidase regulatory region-containingprotein, putative [Ricinus communis] gi|223545741|gb|EEF47245.1| carboxypeptidase regulatory region-containingprotein, putative [Ricinus communis] Length = 1198 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -2 Query: 435 EYAFLPPAQAIELGSGDSTEITFQATRVAYRSSIIFILL 319 EYAF PPAQAIELGSGD+ E+TF+ATRVAY ++ + LL Sbjct: 915 EYAFSPPAQAIELGSGDTREVTFEATRVAYSATGMITLL 953 >gb|ESR57771.1| hypothetical protein CICLE_v10018561mg [Citrus clementina] Length = 1201 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 435 EYAFLPPAQAIELGSGDSTEITFQATRVAYRSSIIFILL 319 EYAF PPAQAIELGSG+S E+ FQATRVAY ++ LL Sbjct: 917 EYAFSPPAQAIELGSGESREVIFQATRVAYSATGTITLL 955 >ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera] gi|297743995|emb|CBI36965.3| unnamed protein product [Vitis vinifera] Length = 1199 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 435 EYAFLPPAQAIELGSGDSTEITFQATRVAYRSSIIFILL 319 EYAF PPAQAIELGSG+S E+ FQATRVAY ++ LL Sbjct: 915 EYAFSPPAQAIELGSGESREVVFQATRVAYSATGTVTLL 953