BLASTX nr result
ID: Jatropha_contig00003301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00003301 (297 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK98045.1|AF301602_1 ATP1 [Daucus carota] gi|15429018|gb|AAK... 60 4e-07 ref|YP_002608189.1| ATP synthase F1 subunit 1 [Carica papaya] gi... 59 5e-07 dbj|BAE32582.1| unnamed protein product [Mus musculus] 58 1e-06 emb|CBI38498.3| unnamed protein product [Vitis vinifera] 58 1e-06 ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|2099541... 58 1e-06 ref|YP_006666125.1| ATP1 (mitochondrion) [Malus domestica] gi|40... 57 2e-06 ref|YP_004237280.1| ATP synthase F1 subunit 1 (mitochondrion) [R... 57 3e-06 ref|XP_002535554.1| ATP synthase, putative [Ricinus communis] gi... 57 3e-06 ref|XP_006346236.1| PREDICTED: ATP synthase subunit alpha, mitoc... 56 5e-06 gb|AAB03873.1| F1-ATPase alpha subunit [Petunia axillaris subsp.... 56 5e-06 emb|CAA53716.1| truncated putative F1-ATP synthase subunit alpha... 56 5e-06 ref|YP_173459.1| ATP synthase F1 subunit 1 [Nicotiana tabacum] g... 56 5e-06 dbj|BAN09106.1| ATP synthase subunit 1 (mitochondrion) [Solanum ... 55 7e-06 dbj|BAN09100.1| ATP synthase subunit 1 (mitochondrion) [Solanum ... 55 7e-06 >gb|AAK98045.1|AF301602_1 ATP1 [Daucus carota] gi|15429018|gb|AAK98046.1|AF301604_1 ATP1 [Daucus carota] Length = 513 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 5 IKPELLQKLLEKDGLTNERKIEPDAFLKESAFR 103 I PELLQKLLEK GLTNERK+EPDAFLKESAF+ Sbjct: 475 IIPELLQKLLEKGGLTNERKMEPDAFLKESAFK 507 >ref|YP_002608189.1| ATP synthase F1 subunit 1 [Carica papaya] gi|170522368|gb|ACB20478.1| ATP synthase F1 subunit 1 (mitochondrion) [Carica papaya] Length = 509 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 SIKPELLQ LLEK GLTNERK+EPDAFLKESA Sbjct: 474 SIKPELLQSLLEKGGLTNERKMEPDAFLKESA 505 >dbj|BAE32582.1| unnamed protein product [Mus musculus] Length = 509 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 5 IKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 IKPELLQ LLEK GLTNERK+EPDAFLKESA Sbjct: 475 IKPELLQSLLEKGGLTNERKMEPDAFLKESA 505 >emb|CBI38498.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 SIKPE LQ LLEK GLTNERK+EPDAFLKESA Sbjct: 259 SIKPEFLQSLLEKGGLTNERKMEPDAFLKESA 290 >ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|209954192|emb|CAQ77653.1| ATPase subunit 1 [Vitis vinifera] gi|239764719|gb|ACS15190.1| ATPase subunit 1 [Vitis vinifera] Length = 509 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 SIKPE LQ LLEK GLTNERK+EPDAFLKESA Sbjct: 474 SIKPEFLQSLLEKGGLTNERKMEPDAFLKESA 505 >ref|YP_006666125.1| ATP1 (mitochondrion) [Malus domestica] gi|401661928|emb|CBX33384.1| atp1 (mitochondrion) [Malus domestica] Length = 510 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ LLEK GLTNERK+EPD FLKESA Sbjct: 474 SVKPELLQSLLEKGGLTNERKMEPDTFLKESA 505 >ref|YP_004237280.1| ATP synthase F1 subunit 1 (mitochondrion) [Ricinus communis] gi|322394287|gb|ADW96044.1| ATP synthase F1 subunit 1 (mitochondrion) [Ricinus communis] Length = 509 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 SIKPELL+ LLEK GLTNERK+EPDAFLKE+A Sbjct: 474 SIKPELLKSLLEKGGLTNERKMEPDAFLKENA 505 >ref|XP_002535554.1| ATP synthase, putative [Ricinus communis] gi|223522668|gb|EEF26828.1| ATP synthase, putative [Ricinus communis] Length = 362 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 SIKPELL+ LLEK GLTNERK+EPDAFLKE+A Sbjct: 327 SIKPELLKSLLEKGGLTNERKMEPDAFLKENA 358 >ref|XP_006346236.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like [Solanum tuberosum] Length = 234 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 197 SVKPELLQSFLEKGGLTNERKMEPDTFLKESA 228 >gb|AAB03873.1| F1-ATPase alpha subunit [Petunia axillaris subsp. parodii] gi|1421801|gb|AAB03874.1| F1-ATPase alpha subunit [Petunia axillaris subsp. parodii] Length = 509 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 474 SVKPELLQSFLEKGGLTNERKMEPDTFLKESA 505 >emb|CAA53716.1| truncated putative F1-ATP synthase subunit alpha [Nicotiana tabacum x Nicotiana bigelovii] gi|457793|emb|CAA54916.1| mitochondrial truncated atpA gene [Nicotiana tabacum] gi|1093821|prf||2104428A orf38/220 Length = 258 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 223 SVKPELLQSFLEKGGLTNERKMEPDTFLKESA 254 >ref|YP_173459.1| ATP synthase F1 subunit 1 [Nicotiana tabacum] gi|114407|sp|P05495.1|ATPAM_NICPL RecName: Full=ATP synthase subunit alpha, mitochondrial gi|13153|emb|CAA30568.1| unnamed protein product [Nicotiana plumbaginifolia] Length = 509 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 474 SVKPELLQSFLEKGGLTNERKMEPDTFLKESA 505 >dbj|BAN09106.1| ATP synthase subunit 1 (mitochondrion) [Solanum melongena] Length = 511 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ EK GLTNERKIEPD FLKESA Sbjct: 474 SVKPELLQSFFEKGGLTNERKIEPDTFLKESA 505 >dbj|BAN09100.1| ATP synthase subunit 1 (mitochondrion) [Solanum kurzii] gi|472824900|dbj|BAN09103.1| ATP synthase subunit 1 (mitochondrion) [Solanum aethiopicum] Length = 511 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +2 Query: 2 SIKPELLQKLLEKDGLTNERKIEPDAFLKESA 97 S+KPELLQ EK GLTNERKIEPD FLKESA Sbjct: 474 SVKPELLQSFFEKGGLTNERKIEPDTFLKESA 505