BLASTX nr result
ID: Jatropha_contig00003232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00003232 (133 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517647.1| AMP-activated protein kinase, gamma regulato... 70 4e-10 >ref|XP_002517647.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223543279|gb|EEF44811.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Length = 403 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +2 Query: 2 ALQTWLPLSALEFTEHISASPVYASPNAYNVLPXELVTCYPESP 133 ALQTWLPL+ALEFTE ++++P+YASPNA N+ P ELVTCY SP Sbjct: 311 ALQTWLPLTALEFTESVASAPIYASPNASNMPPRELVTCYLGSP 354