BLASTX nr result
ID: Jatropha_contig00002850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002850 (406 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517038.1| conserved hypothetical protein [Ricinus comm... 112 6e-23 ref|XP_002311651.1| predicted protein [Populus trichocarpa] gi|1... 108 7e-22 gb|EMJ24173.1| hypothetical protein PRUPE_ppa005335mg [Prunus pe... 107 2e-21 ref|XP_004134107.1| PREDICTED: uncharacterized protein LOC101219... 103 2e-20 gb|ESW17920.1| hypothetical protein PHAVU_007G279400g [Phaseolus... 102 5e-20 ref|XP_002283908.1| PREDICTED: AT-rich interactive domain-contai... 102 5e-20 gb|ESR33312.1| hypothetical protein CICLE_v10004932mg [Citrus cl... 101 8e-20 gb|ESR33311.1| hypothetical protein CICLE_v10004932mg [Citrus cl... 101 8e-20 ref|XP_003536553.1| PREDICTED: uncharacterized protein LOC100790... 100 1e-19 ref|XP_004498008.1| PREDICTED: uncharacterized protein LOC101505... 100 2e-19 ref|XP_003519040.1| PREDICTED: uncharacterized protein LOC100814... 99 6e-19 ref|XP_004296608.1| PREDICTED: uncharacterized protein LOC101307... 97 3e-18 gb|EOY05844.1| ARM repeat superfamily protein [Theobroma cacao] 95 8e-18 gb|ESQ47558.1| hypothetical protein EUTSA_v10020692mg [Eutrema s... 93 4e-17 ref|NP_566721.1| armadillo-repeat containing protein [Arabidopsi... 92 5e-17 gb|AAM61439.1| unknown [Arabidopsis thaliana] 92 5e-17 ref|XP_006297648.1| hypothetical protein CARUB_v10013666mg [Caps... 91 1e-16 ref|XP_003637544.1| hypothetical protein MTR_090s0013 [Medicago ... 91 1e-16 ref|XP_003637028.1| hypothetical protein MTR_067s0040, partial [... 91 1e-16 ref|XP_002883390.1| hypothetical protein ARALYDRAFT_479809 [Arab... 89 4e-16 >ref|XP_002517038.1| conserved hypothetical protein [Ricinus communis] gi|223543673|gb|EEF45201.1| conserved hypothetical protein [Ricinus communis] Length = 412 Score = 112 bits (279), Expect = 6e-23 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKF AARGVWGM Sbjct: 357 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFAAARGVWGM 412 >ref|XP_002311651.1| predicted protein [Populus trichocarpa] gi|118487781|gb|ABK95714.1| unknown [Populus trichocarpa] gi|222851471|gb|EEE89018.1| hypothetical protein POPTR_0008s15980g [Populus trichocarpa] Length = 453 Score = 108 bits (270), Expect = 7e-22 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQN+ALLLAYENAFAEILFS++RYSDTFARILYELTSRP+NKFTAARGVWGM Sbjct: 398 LVSEPQNKALLLAYENAFAEILFSDTRYSDTFARILYELTSRPSNKFTAARGVWGM 453 >gb|EMJ24173.1| hypothetical protein PRUPE_ppa005335mg [Prunus persica] Length = 466 Score = 107 bits (266), Expect = 2e-21 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNRALLLAYENAFAEILFS++RYSDTFARILYELTSRPNNK AARGVWGM Sbjct: 411 LVSEPQNRALLLAYENAFAEILFSDARYSDTFARILYELTSRPNNKVAAARGVWGM 466 >ref|XP_004134107.1| PREDICTED: uncharacterized protein LOC101219772 [Cucumis sativus] gi|449516049|ref|XP_004165060.1| PREDICTED: uncharacterized LOC101219772 [Cucumis sativus] Length = 460 Score = 103 bits (257), Expect = 2e-20 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR LLLAYENAFAEILFS+ RYSDTFARILYELTSRPNNK AA+GVWGM Sbjct: 405 LVSEPQNRGLLLAYENAFAEILFSDGRYSDTFARILYELTSRPNNKVAAAQGVWGM 460 >gb|ESW17920.1| hypothetical protein PHAVU_007G279400g [Phaseolus vulgaris] Length = 491 Score = 102 bits (254), Expect = 5e-20 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR+LLLAYENAFAEILF++ RYSDTFARILYELTSRPNNK ARG+WGM Sbjct: 436 LVSEPQNRSLLLAYENAFAEILFTDGRYSDTFARILYELTSRPNNKVATARGIWGM 491 >ref|XP_002283908.1| PREDICTED: AT-rich interactive domain-containing protein 2 [Vitis vinifera] gi|147794687|emb|CAN69148.1| hypothetical protein VITISV_003946 [Vitis vinifera] gi|297737139|emb|CBI26340.3| unnamed protein product [Vitis vinifera] Length = 457 Score = 102 bits (254), Expect = 5e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNRA LLAYENAFAEILFS+ R+SDTFARILYELTSRPNNK AARG+WGM Sbjct: 402 LVSEPQNRAQLLAYENAFAEILFSDGRHSDTFARILYELTSRPNNKMAAARGIWGM 457 >gb|ESR33312.1| hypothetical protein CICLE_v10004932mg [Citrus clementina] Length = 356 Score = 101 bits (252), Expect = 8e-20 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWG 165 LVSEPQNR LLLAYENAFAEILFS+ RYSDTFARILYELTSRPNNK +ARG+WG Sbjct: 300 LVSEPQNRVLLLAYENAFAEILFSDGRYSDTFARILYELTSRPNNKVASARGIWG 354 >gb|ESR33311.1| hypothetical protein CICLE_v10004932mg [Citrus clementina] Length = 462 Score = 101 bits (252), Expect = 8e-20 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWG 165 LVSEPQNR LLLAYENAFAEILFS+ RYSDTFARILYELTSRPNNK +ARG+WG Sbjct: 406 LVSEPQNRVLLLAYENAFAEILFSDGRYSDTFARILYELTSRPNNKVASARGIWG 460 >ref|XP_003536553.1| PREDICTED: uncharacterized protein LOC100790539 [Glycine max] Length = 460 Score = 100 bits (250), Expect = 1e-19 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR+LLLAYENAFAEI+F++ RYSDTFARILYELTSRP+NK AARG+WGM Sbjct: 405 LVSEPQNRSLLLAYENAFAEIVFTDGRYSDTFARILYELTSRPSNKVAAARGIWGM 460 >ref|XP_004498008.1| PREDICTED: uncharacterized protein LOC101505343 [Cicer arietinum] Length = 460 Score = 100 bits (249), Expect = 2e-19 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR LLLAYENAFAEILF++S+YSDTFARILYELTSRP+NK ARG+WGM Sbjct: 405 LVSEPQNRTLLLAYENAFAEILFTDSKYSDTFARILYELTSRPSNKVATARGIWGM 460 >ref|XP_003519040.1| PREDICTED: uncharacterized protein LOC100814807 [Glycine max] Length = 460 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/56 (82%), Positives = 53/56 (94%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR+LLLAYENAFAEI+F++ RYSDTFARILYELTSRP++K AARG+WGM Sbjct: 405 LVSEPQNRSLLLAYENAFAEIVFTDGRYSDTFARILYELTSRPSSKVAAARGIWGM 460 >ref|XP_004296608.1| PREDICTED: uncharacterized protein LOC101307295 [Fragaria vesca subsp. vesca] Length = 464 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR +LLAYENAFAE+LFS++R S+ FARILYELTSRPNNK AARG+WGM Sbjct: 409 LVSEPQNRGMLLAYENAFAEVLFSDTRCSEIFARILYELTSRPNNKVAAARGIWGM 464 >gb|EOY05844.1| ARM repeat superfamily protein [Theobroma cacao] Length = 458 Score = 95.1 bits (235), Expect = 8e-18 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 L S+PQNR LLAYENAFAEILFS+ R+SDTFARIL+ELTS+PNNK AARG+WGM Sbjct: 403 LASDPQNRQSLLAYENAFAEILFSDGRHSDTFARILFELTSKPNNKMAAARGIWGM 458 >gb|ESQ47558.1| hypothetical protein EUTSA_v10020692mg [Eutrema salsugineum] Length = 460 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/56 (75%), Positives = 51/56 (91%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNRALLLAYENAFAE+LF + +YSD+FARILYELT+R N++ +ARG+WGM Sbjct: 405 LVSEPQNRALLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWGM 460 >ref|NP_566721.1| armadillo-repeat containing protein [Arabidopsis thaliana] gi|9294188|dbj|BAB02090.1| unnamed protein product [Arabidopsis thaliana] gi|18176265|gb|AAL60013.1| unknown protein [Arabidopsis thaliana] gi|20465317|gb|AAM20062.1| unknown protein [Arabidopsis thaliana] gi|332643182|gb|AEE76703.1| armadillo-repeat containing protein [Arabidopsis thaliana] Length = 460 Score = 92.4 bits (228), Expect = 5e-17 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR LLLAYENAFAE+LF E +YSD+FARILYELT+R N++ +ARG+WGM Sbjct: 405 LVSEPQNRGLLLAYENAFAELLFQEGKYSDSFARILYELTARSNSRVASARGIWGM 460 >gb|AAM61439.1| unknown [Arabidopsis thaliana] Length = 460 Score = 92.4 bits (228), Expect = 5e-17 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR LLLAYENAFAE+LF E +YSD+FARILYELT+R N++ +ARG+WGM Sbjct: 405 LVSEPQNRGLLLAYENAFAELLFQEGKYSDSFARILYELTARSNSRVASARGIWGM 460 >ref|XP_006297648.1| hypothetical protein CARUB_v10013666mg [Capsella rubella] gi|482566357|gb|EOA30546.1| hypothetical protein CARUB_v10013666mg [Capsella rubella] Length = 457 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWGM 168 LVSEPQNR LLLAYENAFAE+LF + +YSD+FARILYELT+R N++ +ARG+WGM Sbjct: 402 LVSEPQNRGLLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWGM 457 >ref|XP_003637544.1| hypothetical protein MTR_090s0013 [Medicago truncatula] gi|355503479|gb|AES84682.1| hypothetical protein MTR_090s0013 [Medicago truncatula] Length = 524 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVW 162 LVSEPQNR LLL YENAFAEILF++S+YSDTFARILYEL+SRP +K ARG+W Sbjct: 440 LVSEPQNRTLLLVYENAFAEILFTDSKYSDTFARILYELSSRPGHKVATARGIW 493 >ref|XP_003637028.1| hypothetical protein MTR_067s0040, partial [Medicago truncatula] gi|355502963|gb|AES84166.1| hypothetical protein MTR_067s0040, partial [Medicago truncatula] Length = 444 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVW 162 LVSEPQNR LLL YENAFAEILF++S+YSDTFARILYEL+SRP +K ARG+W Sbjct: 360 LVSEPQNRTLLLVYENAFAEILFTDSKYSDTFARILYELSSRPGHKVATARGIW 413 >ref|XP_002883390.1| hypothetical protein ARALYDRAFT_479809 [Arabidopsis lyrata subsp. lyrata] gi|297329230|gb|EFH59649.1| hypothetical protein ARALYDRAFT_479809 [Arabidopsis lyrata subsp. lyrata] Length = 395 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/55 (72%), Positives = 49/55 (89%) Frame = +1 Query: 1 LVSEPQNRALLLAYENAFAEILFSESRYSDTFARILYELTSRPNNKFTAARGVWG 165 LVSEPQNR LLLAYENAFAE+LF + +YSD+FARILYELT+R N++ +ARG+WG Sbjct: 341 LVSEPQNRGLLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWG 395