BLASTX nr result
ID: Jatropha_contig00002822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002822 (504 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR54859.1| hypothetical protein CICLE_v10020832mg [Citrus cl... 60 4e-07 >gb|ESR54859.1| hypothetical protein CICLE_v10020832mg [Citrus clementina] Length = 355 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = +1 Query: 322 MKGLSLYRRSYLVLFRRERAPNQSYALLPSTSFST---YDNSSNDDLPNSRVQIFDRHLK 492 M+ ++RS L+L RR RA N+ YAL+PS SF T ++ +SND +SRV IFDRHLK Sbjct: 1 MRAFGAFQRSSLLL-RRRRANNEPYALVPSGSFCTDNGFETTSND---SSRVSIFDRHLK 56 Query: 493 RKQR 504 RKQR Sbjct: 57 RKQR 60