BLASTX nr result
ID: Jatropha_contig00002813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002813 (522 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS67832.1| 50S ribosomal protein L2, chloroplastic [Triticum... 142 5e-60 gb|EMS63307.1| 50S ribosomal protein L2, chloroplastic [Triticum... 142 5e-60 ref|YP_002720153.1| rpl2 [Jatropha curcas] gi|224979605|gb|ACN72... 157 1e-36 ref|YP_740517.1| ribosomal protein L2 [Citrus sinensis] gi|11432... 156 3e-36 gb|AGK82954.1| ribosomal protein L2 (chloroplast) [Lupinus luteu... 155 4e-36 ref|YP_007889903.1| ribosomal protein L2 [Francoa sonchifolia] g... 155 4e-36 ref|YP_007375110.1| ribosomal protein L2 [Quercus rubra] gi|4414... 155 4e-36 ref|YP_538976.1| ribosomal protein L2 [Gossypium hirsutum] gi|91... 155 4e-36 ref|YP_247641.1| ribosomal protein L2 [Cucumis sativus] gi|68164... 155 4e-36 gb|AFU96049.1| Rpl2, partial (chloroplast) [Phyllanthus urinaria] 155 4e-36 gb|AFU96048.1| Rpl2, partial (chloroplast) [Pera bumeliifolia] 155 4e-36 gb|AFU96045.1| Rpl2, partial (chloroplast) [Microdesmis casearii... 155 4e-36 gb|AFU96043.1| Rpl2, partial (chloroplast) [Mammea americana] 155 4e-36 gb|AFU96042.1| Rpl2, partial (chloroplast) [Linum usitatissimum] 155 4e-36 gb|AFU96041.1| Rpl2, partial (chloroplast) [Lacistema robustum] 155 4e-36 gb|AFU96039.1| Rpl2, partial (chloroplast) [Irvingia malayana] 155 4e-36 gb|AFU96032.1| Rpl2, partial (chloroplast) [Galearia maingayi] 155 4e-36 gb|AFU96030.1| Rpl2, partial (chloroplast) [Euphorbia maculata] 155 4e-36 gb|AFU96029.1| Rpl2, partial (chloroplast) [Erythroxylum areolatum] 155 4e-36 gb|AFU96021.1| Rpl2, partial (chloroplast) [Caloncoba echinata] 155 4e-36 >gb|EMS67832.1| 50S ribosomal protein L2, chloroplastic [Triticum urartu] Length = 257 Score = 142 bits (357), Expect(2) = 5e-60 Identities = 63/69 (91%), Positives = 66/69 (95%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEG+APIGRKKP TPWGYPALGRR+RKR K Sbjct: 95 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKK 154 Query: 341 YSDNLILRR 315 YSD+ ILRR Sbjct: 155 YSDSFILRR 163 Score = 115 bits (287), Expect(2) = 5e-60 Identities = 56/76 (73%), Positives = 63/76 (82%) Frame = -3 Query: 229 VTRSLKKNPFVANHLLKKINKLNTKAEKEIIATWSRASTIIPTMIGHTIAIHNGKGHLPI 50 VTR K NPFVA+HLL KI K+N K EKE I TWSRAS+I+PTM+GHTIAIHNGK H+PI Sbjct: 165 VTRK-KTNPFVAHHLLAKIEKVNMKEEKETIVTWSRASSILPTMVGHTIAIHNGKEHIPI 223 Query: 49 YITDRMVGHKLGEFSP 2 YIT+ MVG KLGEF P Sbjct: 224 YITNPMVGRKLGEFVP 239 >gb|EMS63307.1| 50S ribosomal protein L2, chloroplastic [Triticum urartu] Length = 257 Score = 142 bits (357), Expect(2) = 5e-60 Identities = 63/69 (91%), Positives = 66/69 (95%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEG+APIGRKKP TPWGYPALGRR+RKR K Sbjct: 95 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKK 154 Query: 341 YSDNLILRR 315 YSD+ ILRR Sbjct: 155 YSDSFILRR 163 Score = 115 bits (287), Expect(2) = 5e-60 Identities = 56/76 (73%), Positives = 63/76 (82%) Frame = -3 Query: 229 VTRSLKKNPFVANHLLKKINKLNTKAEKEIIATWSRASTIIPTMIGHTIAIHNGKGHLPI 50 VTR K NPFVA+HLL KI K+N K EKE I TWSRAS+I+PTM+GHTIAIHNGK H+PI Sbjct: 165 VTRK-KTNPFVAHHLLAKIEKVNMKEEKETIVTWSRASSILPTMVGHTIAIHNGKEHIPI 223 Query: 49 YITDRMVGHKLGEFSP 2 YIT+ MVG KLGEF P Sbjct: 224 YITNPMVGRKLGEFVP 239 >ref|YP_002720153.1| rpl2 [Jatropha curcas] gi|224979605|gb|ACN72732.1| rpl2 [Jatropha curcas] Length = 287 Score = 157 bits (397), Expect = 1e-36 Identities = 72/72 (100%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 216 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 275 Query: 341 YSDNLILRRRTK 306 YSDNLILRRRTK Sbjct: 276 YSDNLILRRRTK 287 >ref|YP_740517.1| ribosomal protein L2 [Citrus sinensis] gi|114329722|ref|YP_740541.1| ribosomal protein L2 [Citrus sinensis] gi|122166128|sp|Q09MB2.1|RK2_CITSI RecName: Full=50S ribosomal protein L2, chloroplastic gi|113952662|gb|ABI49060.1| ribosomal protein L2 [Citrus sinensis] gi|113952688|gb|ABI49086.1| ribosomal protein L2 [Citrus sinensis] Length = 274 Score = 156 bits (394), Expect = 3e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRK+PATPWGYPALGRRSRKRNK Sbjct: 203 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKRPATPWGYPALGRRSRKRNK 262 Query: 341 YSDNLILRRRTK 306 YSDNLILRRRTK Sbjct: 263 YSDNLILRRRTK 274 >gb|AGK82954.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] gi|485474374|gb|AGK82976.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] Length = 274 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 203 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 262 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 263 YSDNLILRRRSK 274 >ref|YP_007889903.1| ribosomal protein L2 [Francoa sonchifolia] gi|386268407|gb|AFJ00513.1| ribosomal protein L2 [Francoa sonchifolia] Length = 274 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 203 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 262 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 263 YSDNLILRRRSK 274 >ref|YP_007375110.1| ribosomal protein L2 [Quercus rubra] gi|441421989|gb|AGC31313.1| ribosomal protein L2 [Quercus rubra] Length = 287 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 216 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 275 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 276 YSDNLILRRRSK 287 >ref|YP_538976.1| ribosomal protein L2 [Gossypium hirsutum] gi|91208966|ref|YP_538999.1| ribosomal protein L2 [Gossypium hirsutum] gi|325210983|ref|YP_004286044.1| ribosomal protein L2 [Gossypium thurberi] gi|372290968|ref|YP_005087733.1| ribosomal protein L2 (chloroplast) [Gossypium raimondii] gi|372290988|ref|YP_005087754.1| ribosomal protein L2 (chloroplast) [Gossypium raimondii] gi|372291069|ref|YP_005087829.1| ribosomal protein L2 (chloroplast) [Gossypium darwinii] gi|372291091|ref|YP_005087850.1| ribosomal protein L2 (chloroplast) [Gossypium darwinii] gi|372291424|ref|YP_005088320.1| ribosomal protein L2 (chloroplast) [Gossypium tomentosum] gi|372291447|ref|YP_005088341.1| ribosomal protein L2 (chloroplast) [Gossypium tomentosum] gi|372291522|ref|YP_005088416.1| ribosomal protein L2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291545|ref|YP_005088437.1| ribosomal protein L2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291812|ref|YP_005088956.1| ribosomal protein L2 (chloroplast) [Gossypium mustelinum] gi|372291833|ref|YP_005088977.1| ribosomal protein L2 (chloroplast) [Gossypium mustelinum] gi|372291896|ref|YP_005089039.1| ribosomal protein L2 (chloroplast) [Gossypium arboreum] gi|372291917|ref|YP_005089060.1| ribosomal protein L2 (chloroplast) [Gossypium arboreum] gi|386800876|ref|YP_006303531.1| ribosomal protein L2 (chloroplast) [Gossypium gossypioides] gi|386800898|ref|YP_006303552.1| ribosomal protein L2 (chloroplast) [Gossypium gossypioides] gi|394830665|ref|YP_006503317.1| ribosomal protein L2 (chloroplast) [Gossypium incanum] gi|394830687|ref|YP_006503338.1| ribosomal protein L2 (chloroplast) [Gossypium incanum] gi|394830752|ref|YP_006503400.1| ribosomal protein L2 (chloroplast) [Gossypium somalense] gi|394830774|ref|YP_006503421.1| ribosomal protein L2 (chloroplast) [Gossypium somalense] gi|394830838|ref|YP_006503483.1| ribosomal protein L2 (chloroplast) [Gossypium capitis-viridis] gi|394830860|ref|YP_006503504.1| ribosomal protein L2 (chloroplast) [Gossypium capitis-viridis] gi|394831014|ref|YP_006503649.1| ribosomal protein L2 (chloroplast) [Gossypium robinsonii] gi|394831036|ref|YP_006503670.1| ribosomal protein L2 (chloroplast) [Gossypium robinsonii] gi|118597127|sp|Q2L944.1|RK2_GOSHI RecName: Full=50S ribosomal protein L2, chloroplastic gi|85687455|gb|ABC73667.1| ribosomal protein L2 [Gossypium hirsutum] gi|85687480|gb|ABC73692.1| ribosomal protein L2 [Gossypium hirsutum] gi|290775845|gb|ADD62341.1| ribosomal protein L2 [Gossypium thurberi] gi|318084355|gb|ADV38831.1| ribosomal protein L2 (chloroplast) [Gossypium arboreum] gi|318084376|gb|ADV38852.1| ribosomal protein L2 (chloroplast) [Gossypium arboreum] gi|318084437|gb|ADV38912.1| ribosomal protein L2 (chloroplast) [Gossypium darwinii] gi|318084459|gb|ADV38934.1| ribosomal protein L2 (chloroplast) [Gossypium darwinii] gi|318084523|gb|ADV38997.1| ribosomal protein L2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084546|gb|ADV39020.1| ribosomal protein L2 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084607|gb|ADV39080.1| ribosomal protein L2 (chloroplast) [Gossypium mustelinum] gi|318084628|gb|ADV39101.1| ribosomal protein L2 (chloroplast) [Gossypium mustelinum] gi|318084686|gb|ADV39158.1| ribosomal protein L2 (chloroplast) [Gossypium raimondii] gi|318084706|gb|ADV39178.1| ribosomal protein L2 (chloroplast) [Gossypium raimondii] gi|318084775|gb|ADV39246.1| ribosomal protein L2 (chloroplast) [Gossypium tomentosum] gi|318084798|gb|ADV39269.1| ribosomal protein L2 (chloroplast) [Gossypium tomentosum] gi|326457078|gb|ADZ74342.1| ribosomal protein L2 [Gossypium anomalum] gi|326457100|gb|ADZ74364.1| ribosomal protein L2 [Gossypium anomalum] gi|326457167|gb|ADZ74430.1| ribosomal protein L2 [Gossypium bickii] gi|326457188|gb|ADZ74451.1| ribosomal protein L2 [Gossypium bickii] gi|326457256|gb|ADZ74518.1| ribosomal protein L2 [Gossypium herbaceum] gi|326457275|gb|ADZ74537.1| ribosomal protein L2 [Gossypium herbaceum] gi|326457341|gb|ADZ74602.1| ribosomal protein L2 [Gossypium longicalyx] gi|326457366|gb|ADZ74627.1| ribosomal protein L2 [Gossypium longicalyx] gi|326457429|gb|ADZ74689.1| ribosomal protein L2 [Gossypium stocksii] gi|326457448|gb|ADZ74708.1| ribosomal protein L2 [Gossypium stocksii] gi|326457517|gb|ADZ74776.1| ribosomal protein L2 [Gossypium sturtianum] gi|326457537|gb|ADZ74796.1| ribosomal protein L2 [Gossypium sturtianum] gi|328924820|gb|ADO64931.2| ribosomal protein L2 [Theobroma cacao] gi|328924842|gb|ADO64953.2| ribosomal protein L2 [Theobroma cacao] gi|329317110|gb|AEB90469.1| ribosomal protein L2 (chloroplast) [Gossypium gossypioides] gi|329317132|gb|AEB90491.1| ribosomal protein L2 (chloroplast) [Gossypium gossypioides] gi|329317194|gb|AEB90552.1| ribosomal protein L2 (chloroplast) [Gossypium hirsutum] gi|329317216|gb|AEB90574.1| ribosomal protein L2 (chloroplast) [Gossypium hirsutum] gi|329317278|gb|AEB90635.1| ribosomal protein L2 (chloroplast) [Gossypium hirsutum] gi|329317300|gb|AEB90657.1| ribosomal protein L2 (chloroplast) [Gossypium hirsutum] gi|329317362|gb|AEB90718.1| ribosomal protein L2 (chloroplast) [Gossypium barbadense] gi|329317384|gb|AEB90740.1| ribosomal protein L2 (chloroplast) [Gossypium barbadense] gi|329317530|gb|AEB90884.1| ribosomal protein L2 (chloroplast) [Gossypium barbadense] gi|329317552|gb|AEB90906.1| ribosomal protein L2 (chloroplast) [Gossypium barbadense] gi|335354370|gb|AEH42990.1| ribosomal protein L2 [Gossypium incanum] gi|335354392|gb|AEH43012.1| ribosomal protein L2 [Gossypium incanum] gi|335354454|gb|AEH43073.1| ribosomal protein L2 [Gossypium somalense] gi|335354476|gb|AEH43095.1| ribosomal protein L2 [Gossypium somalense] gi|335354538|gb|AEH43156.1| ribosomal protein L2 (chloroplast) [Gossypium capitis-viridis] gi|335354560|gb|AEH43178.1| ribosomal protein L2 (chloroplast) [Gossypium capitis-viridis] gi|335354706|gb|AEH43322.1| ribosomal protein L2 [Gossypium robinsonii] gi|335354728|gb|AEH43344.1| ribosomal protein L2 [Gossypium robinsonii] Length = 274 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 203 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 262 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 263 YSDNLILRRRSK 274 >ref|YP_247641.1| ribosomal protein L2 [Cucumis sativus] gi|68164867|ref|YP_247663.1| ribosomal protein L2 [Cucumis sativus] gi|346578233|ref|YP_004841825.1| ribosomal protein L2 [Cucumis melo subsp. melo] gi|75317294|sp|Q4VZK5.1|RK2_CUCSA RecName: Full=50S ribosomal protein L2, chloroplastic gi|67511440|emb|CAJ00800.1| ribosomal protein L2 [Cucumis sativus] gi|67511462|emb|CAJ00822.1| ribosomal protein L2 [Cucumis sativus] gi|74027141|gb|AAZ94691.1| ribosomal protein L2 [Cucumis sativus] gi|74027158|gb|AAZ94708.1| ribosomal protein L2 [Cucumis sativus] gi|115498345|gb|ABI98787.1| ribosomal protein L2 [Cucumis sativus] gi|344030533|gb|AEM76934.1| ribosomal protein L2 [Cucumis melo subsp. melo] Length = 274 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 203 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 262 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 263 YSDNLILRRRSK 274 >gb|AFU96049.1| Rpl2, partial (chloroplast) [Phyllanthus urinaria] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96048.1| Rpl2, partial (chloroplast) [Pera bumeliifolia] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96045.1| Rpl2, partial (chloroplast) [Microdesmis caseariifolia] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96043.1| Rpl2, partial (chloroplast) [Mammea americana] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96042.1| Rpl2, partial (chloroplast) [Linum usitatissimum] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96041.1| Rpl2, partial (chloroplast) [Lacistema robustum] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96039.1| Rpl2, partial (chloroplast) [Irvingia malayana] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96032.1| Rpl2, partial (chloroplast) [Galearia maingayi] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96030.1| Rpl2, partial (chloroplast) [Euphorbia maculata] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96029.1| Rpl2, partial (chloroplast) [Erythroxylum areolatum] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280 >gb|AFU96021.1| Rpl2, partial (chloroplast) [Caloncoba echinata] Length = 280 Score = 155 bits (393), Expect = 4e-36 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = -2 Query: 521 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 342 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK Sbjct: 209 LGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNK 268 Query: 341 YSDNLILRRRTK 306 YSDNLILRRR+K Sbjct: 269 YSDNLILRRRSK 280