BLASTX nr result
ID: Jatropha_contig00002688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002688 (528 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatrop... 111 8e-23 ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [... 106 3e-21 gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Maniho... 103 2e-20 gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Maniho... 103 2e-20 gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus cl... 100 3e-19 gb|ABL67651.1| putative auxin-repressed/dormancy-associated prot... 100 3e-19 gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] 99 4e-19 gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] 99 7e-19 ref|NP_565772.1| dormancy/auxin associated protein [Arabidopsis ... 97 2e-18 ref|NP_850220.1| dormancy/auxin associated protein [Arabidopsis ... 97 2e-18 ref|XP_002881308.1| dormancy/auxin associated family protein [Ar... 97 3e-18 ref|XP_006295284.1| hypothetical protein CARUB_v10024372mg [Caps... 96 5e-18 ref|XP_006343230.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 96 6e-18 ref|XP_006343229.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 96 6e-18 gb|AFW90622.1| auxin-repressed protein [Solanum tuberosum] 96 6e-18 gb|AAS76635.1| auxin-repressed protein [Nicotiana tabacum] 95 8e-18 gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] 95 8e-18 gb|AAS75891.1| auxin-repressed protein [Solanum virginianum] 95 8e-18 gb|AAO32054.1| auxin-repressed protein [Brassica rapa subsp. pek... 95 1e-17 gb|AAL67436.1|AF458410_1 auxin-repressed protein [Brassica olera... 95 1e-17 >gb|ADB02903.1| auxin-repressed protein-like protein ARP1 [Jatropha curcas] Length = 120 Score = 111 bits (278), Expect = 8e-23 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR Sbjct: 70 RKDNVWRSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 120 >ref|XP_002509446.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] gi|223549345|gb|EEF50833.1| Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] Length = 118 Score = 106 bits (264), Expect = 3e-21 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVFHPGSNLAT+G+GAQLFDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 68 RKDNVWRSVFHPGSNLATRGIGAQLFDKPSQPNSPTVYDWLYSGETRSKHR 118 >gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Manihot esculenta] Length = 68 Score = 103 bits (257), Expect = 2e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVFHPGSNLATKGLGAQLFDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 19 RKDNVWRSVFHPGSNLATKGLGAQLFDKP-QPNSPTVYDWLYSGETRSKHR 68 >gb|AAX84677.1| auxin-repressed protein-like protein ARP1 [Manihot esculenta] Length = 117 Score = 103 bits (257), Expect = 2e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVFHPGSNLATKGLGAQLFDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 68 RKDNVWRSVFHPGSNLATKGLGAQLFDKP-QPNSPTVYDWLYSGETRSKHR 117 >gb|ESR62618.1| hypothetical protein CICLE_v10017162mg [Citrus clementina] Length = 122 Score = 99.8 bits (247), Expect = 3e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 213 RKDNVW SVFHPGSNLAT+G+GA++FDKP PNSPTVYDWLYSG+TRSKH Sbjct: 71 RKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 >gb|ABL67651.1| putative auxin-repressed/dormancy-associated protein [Citrus hybrid cultivar] Length = 122 Score = 99.8 bits (247), Expect = 3e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 213 RKDNVW SVFHPGSNLAT+G+GA++FDKP PNSPTVYDWLYSG+TRSKH Sbjct: 71 RKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 >gb|AAC62104.2| auxin-repressed protein [Elaeagnus umbellata] Length = 120 Score = 99.4 bits (246), Expect = 4e-19 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RK+NVW SVF+PGSNLAT+GLG ++FDKP QPNSPTVYDWLYSG+TRSKHR Sbjct: 70 RKENVWRSVFNPGSNLATRGLGTEMFDKPSQPNSPTVYDWLYSGETRSKHR 120 >gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 98.6 bits (244), Expect = 7e-19 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 49 PSFLCRKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 PS RKDNVW SVF+PGSNLATKGLG+ LFDKP +PNSPTVYDWLYSG+TRSKHR Sbjct: 65 PSPTARKDNVWRSVFNPGSNLATKGLGSALFDKP-EPNSPTVYDWLYSGETRSKHR 119 >ref|NP_565772.1| dormancy/auxin associated protein [Arabidopsis thaliana] gi|20198309|gb|AAC69134.2| putative auxin-regulated protein [Arabidopsis thaliana] gi|21553815|gb|AAM62908.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330253797|gb|AEC08891.1| dormancy/auxin associated protein [Arabidopsis thaliana] Length = 106 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RK+NVW SVFHPGSN+AT+G+G LFDKP PNSPTVYDWLYS DTRSKHR Sbjct: 56 RKENVWRSVFHPGSNIATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR 106 >ref|NP_850220.1| dormancy/auxin associated protein [Arabidopsis thaliana] gi|13605730|gb|AAK32858.1|AF361846_1 At2g33830/T1B8.13 [Arabidopsis thaliana] gi|11127601|dbj|BAB17679.1| Dormancy-associated protein homolog [Arabidopsis thaliana] gi|17978893|gb|AAL47416.1| At2g33830/T1B8.13 [Arabidopsis thaliana] gi|330253798|gb|AEC08892.1| dormancy/auxin associated protein [Arabidopsis thaliana] Length = 108 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RK+NVW SVFHPGSN+AT+G+G LFDKP PNSPTVYDWLYS DTRSKHR Sbjct: 58 RKENVWRSVFHPGSNIATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR 108 >ref|XP_002881308.1| dormancy/auxin associated family protein [Arabidopsis lyrata subsp. lyrata] gi|297327147|gb|EFH57567.1| dormancy/auxin associated family protein [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 213 RKDNVW SVFHPGSN+ATKG G LFDKP PNSPTVYDWLYS DTRSKH Sbjct: 58 RKDNVWRSVFHPGSNIATKGRGTNLFDKPSHPNSPTVYDWLYSDDTRSKH 107 >ref|XP_006295284.1| hypothetical protein CARUB_v10024372mg [Capsella rubella] gi|482563992|gb|EOA28182.1| hypothetical protein CARUB_v10024372mg [Capsella rubella] Length = 108 Score = 95.9 bits (237), Expect = 5e-18 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RK+NVW SVFHPGSN+AT+G+G LFDKP PNSPTVYDWLYS DTRS+HR Sbjct: 58 RKENVWRSVFHPGSNIATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSQHR 108 >ref|XP_006343230.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Solanum tuberosum] Length = 123 Score = 95.5 bits (236), Expect = 6e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVF+PGSN+ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 73 RKDNVWRSVFNPGSNIATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 123 >ref|XP_006343229.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Solanum tuberosum] Length = 129 Score = 95.5 bits (236), Expect = 6e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVF+PGSN+ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 79 RKDNVWRSVFNPGSNIATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 129 >gb|AFW90622.1| auxin-repressed protein [Solanum tuberosum] Length = 127 Score = 95.5 bits (236), Expect = 6e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RKDNVW SVF+PGSN+ATK +GA++FDKP PN+PTVYDWLYSGDTRSKH+ Sbjct: 77 RKDNVWRSVFNPGSNIATKRIGAEVFDKPSHPNAPTVYDWLYSGDTRSKHQ 127 >gb|AAS76635.1| auxin-repressed protein [Nicotiana tabacum] Length = 124 Score = 95.1 bits (235), Expect = 8e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 213 RK+NVW SVFHPGSNLATK +GA++FDKP PN+PTVYDWLYSG+TRSKH Sbjct: 71 RKENVWRSVFHPGSNLATKRIGAEVFDKPSHPNAPTVYDWLYSGNTRSKH 120 >gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] Length = 126 Score = 95.1 bits (235), Expect = 8e-18 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = +1 Query: 28 GHQRRLGPSFLCRKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRS 207 G +G RKDNVW SVF+PGSNLAT+G+G+ +FDKP QPNSPTVYDWLYSGDTRS Sbjct: 64 GSPSSVGSPSSVRKDNVWRSVFNPGSNLATRGIGSNVFDKP-QPNSPTVYDWLYSGDTRS 122 Query: 208 KH 213 KH Sbjct: 123 KH 124 >gb|AAS75891.1| auxin-repressed protein [Solanum virginianum] Length = 124 Score = 95.1 bits (235), Expect = 8e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKH 213 RK+NVW SVFHPGSNLATK +GA++FDKP PN+PTVYDWLYSG+TRSKH Sbjct: 71 RKENVWRSVFHPGSNLATKRIGAEVFDKPSHPNAPTVYDWLYSGNTRSKH 120 >gb|AAO32054.1| auxin-repressed protein [Brassica rapa subsp. pekinensis] Length = 106 Score = 94.7 bits (234), Expect = 1e-17 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RK+NVW SVFHPGSN+AT+G+G LFDKP PN+PTVYDWLYS DTRS+HR Sbjct: 56 RKENVWRSVFHPGSNIATRGMGTNLFDKPSHPNAPTVYDWLYSDDTRSQHR 106 >gb|AAL67436.1|AF458410_1 auxin-repressed protein [Brassica oleracea] gi|310896446|gb|ADP37970.1| auxin-repressed protein [Brassica napus] Length = 105 Score = 94.7 bits (234), Expect = 1e-17 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +1 Query: 64 RKDNVWTSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 216 RK+NVW SVFHPGSN+AT+G+G LFDKP PN+PTVYDWLYS DTRS+HR Sbjct: 55 RKENVWRSVFHPGSNIATRGMGTNLFDKPSHPNAPTVYDWLYSDDTRSQHR 105