BLASTX nr result
ID: Jatropha_contig00002683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002683 (651 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317584.1| predicted protein [Populus trichocarpa] gi|2... 61 2e-07 ref|XP_002319823.1| predicted protein [Populus trichocarpa] gi|5... 61 2e-07 ref|XP_006366045.1| PREDICTED: septum-promoting GTP-binding prot... 58 2e-06 ref|XP_004244140.1| PREDICTED: septum-promoting GTP-binding prot... 58 2e-06 ref|XP_004142559.1| PREDICTED: septum-promoting GTP-binding prot... 58 2e-06 ref|NP_200295.1| monomeric G protein SGP1 [Arabidopsis thaliana]... 58 2e-06 ref|XP_002866063.1| GTP-binding family protein [Arabidopsis lyra... 58 2e-06 gb|ESR65469.1| hypothetical protein CICLE_v10009122mg [Citrus cl... 58 3e-06 gb|ESQ42977.1| hypothetical protein EUTSA_v10014284mg [Eutrema s... 58 3e-06 gb|ERN19526.1| hypothetical protein AMTR_s00062p00045770 [Ambore... 58 3e-06 gb|EOY12470.1| Ras-related small GTP-binding family protein isof... 58 3e-06 ref|XP_004491360.1| PREDICTED: septum-promoting GTP-binding prot... 58 3e-06 ref|XP_006280915.1| hypothetical protein CARUB_v10026908mg [Caps... 58 3e-06 ref|XP_004294357.1| PREDICTED: septum-promoting GTP-binding prot... 58 3e-06 gb|EMJ13005.1| hypothetical protein PRUPE_ppa009883mg [Prunus pe... 58 3e-06 ref|XP_003617481.1| Ras-related protein Rab-37 [Medicago truncat... 58 3e-06 gb|ESW18407.1| hypothetical protein PHAVU_006G038400g [Phaseolus... 57 6e-06 ref|XP_003533896.1| PREDICTED: septum-promoting GTP-binding prot... 57 6e-06 ref|XP_003519565.1| PREDICTED: septum-promoting GTP-binding prot... 57 6e-06 gb|ACU24471.1| unknown [Glycine max] 57 6e-06 >ref|XP_002317584.1| predicted protein [Populus trichocarpa] gi|222860649|gb|EEE98196.1| hypothetical protein POPTR_0011s13960g [Populus trichocarpa] Length = 278 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFVQLPPNLQW IVTQ Sbjct: 196 QTAIPILIGTKFDDFVQLPPNLQWTIVTQ 224 >ref|XP_002319823.1| predicted protein [Populus trichocarpa] gi|550349870|gb|ERP67233.1| hypothetical protein POPTR_0001s44670g [Populus trichocarpa] Length = 279 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFVQLPPNLQW IVTQ Sbjct: 197 QTAIPILIGTKFDDFVQLPPNLQWTIVTQ 225 >ref|XP_006366045.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum tuberosum] Length = 289 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFVQLPP++QW +VTQ Sbjct: 207 QTAIPILIGTKFDDFVQLPPDIQWSVVTQ 235 >ref|XP_004244140.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum lycopersicum] Length = 289 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFVQLPP++QW +VTQ Sbjct: 207 QTAIPILIGTKFDDFVQLPPDIQWSVVTQ 235 >ref|XP_004142559.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Cucumis sativus] gi|449485370|ref|XP_004157147.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Cucumis sativus] Length = 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPPNLQW IV+Q Sbjct: 226 QTAIPILIGTKFDDFVRLPPNLQWTIVSQ 254 >ref|NP_200295.1| monomeric G protein SGP1 [Arabidopsis thaliana] gi|5824341|emb|CAB54517.1| SGP1 monomeric G-protein [Arabidopsis thaliana] gi|9758264|dbj|BAB08763.1| SGP1 monomeric G-protein [Arabidopsis thaliana] gi|332009163|gb|AED96546.1| monomeric G protein SGP1 [Arabidopsis thaliana] Length = 288 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 +TAIPILIGTKFDDFV+LPPNLQW IVTQ Sbjct: 204 KTAIPILIGTKFDDFVRLPPNLQWTIVTQ 232 >ref|XP_002866063.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297311898|gb|EFH42322.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 288 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 +TAIPILIGTKFDDFV+LPPNLQW IVTQ Sbjct: 204 KTAIPILIGTKFDDFVRLPPNLQWTIVTQ 232 >gb|ESR65469.1| hypothetical protein CICLE_v10009122mg [Citrus clementina] Length = 233 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQV 401 QTAIPILIGTKFDDFV+LPP+LQW I TQV Sbjct: 202 QTAIPILIGTKFDDFVRLPPDLQWTIATQV 231 >gb|ESQ42977.1| hypothetical protein EUTSA_v10014284mg [Eutrema salsugineum] Length = 287 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 487 TAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 TAIPILIGTKFDDFV+LPPNLQW IVTQ Sbjct: 204 TAIPILIGTKFDDFVRLPPNLQWTIVTQ 231 >gb|ERN19526.1| hypothetical protein AMTR_s00062p00045770 [Amborella trichopoda] Length = 107 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQVT*FLYL 383 QTAIPILIGTKFDDFV LPP++QW IV QV L++ Sbjct: 72 QTAIPILIGTKFDDFVHLPPDIQWTIVNQVPYLLFM 107 >gb|EOY12470.1| Ras-related small GTP-binding family protein isoform 2 [Theobroma cacao] Length = 282 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP+LQW IVTQ Sbjct: 200 QTAIPILIGTKFDDFVRLPPDLQWTIVTQ 228 >ref|XP_004491360.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Cicer arietinum] Length = 278 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP+LQW IVTQ Sbjct: 196 QTAIPILIGTKFDDFVRLPPDLQWTIVTQ 224 >ref|XP_006280915.1| hypothetical protein CARUB_v10026908mg [Capsella rubella] gi|482549619|gb|EOA13813.1| hypothetical protein CARUB_v10026908mg [Capsella rubella] Length = 287 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 487 TAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 TAIPILIGTKFDDFV+LPPNLQW IVTQ Sbjct: 204 TAIPILIGTKFDDFVRLPPNLQWTIVTQ 231 >ref|XP_004294357.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Fragaria vesca subsp. vesca] Length = 283 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP+LQW IVTQ Sbjct: 201 QTAIPILIGTKFDDFVRLPPDLQWTIVTQ 229 >gb|EMJ13005.1| hypothetical protein PRUPE_ppa009883mg [Prunus persica] Length = 273 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP+LQW IVTQ Sbjct: 191 QTAIPILIGTKFDDFVRLPPDLQWTIVTQ 219 >ref|XP_003617481.1| Ras-related protein Rab-37 [Medicago truncatula] gi|355518816|gb|AET00440.1| Ras-related protein Rab-37 [Medicago truncatula] Length = 289 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP+LQW IVTQ Sbjct: 207 QTAIPILIGTKFDDFVRLPPDLQWTIVTQ 235 >gb|ESW18407.1| hypothetical protein PHAVU_006G038400g [Phaseolus vulgaris] Length = 279 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP++QW IVTQ Sbjct: 197 QTAIPILIGTKFDDFVRLPPDVQWTIVTQ 225 >ref|XP_003533896.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] Length = 310 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP++QW IVTQ Sbjct: 228 QTAIPILIGTKFDDFVKLPPDVQWTIVTQ 256 >ref|XP_003519565.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] Length = 282 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP++QW IVTQ Sbjct: 200 QTAIPILIGTKFDDFVRLPPDVQWTIVTQ 228 >gb|ACU24471.1| unknown [Glycine max] Length = 289 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 490 QTAIPILIGTKFDDFVQLPPNLQWPIVTQ 404 QTAIPILIGTKFDDFV+LPP++QW IVTQ Sbjct: 207 QTAIPILIGTKFDDFVKLPPDVQWTIVTQ 235