BLASTX nr result
ID: Jatropha_contig00002651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002651 (189 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525009.1| protoheme IX farnesyltransferase, putative [... 58 1e-06 >ref|XP_002525009.1| protoheme IX farnesyltransferase, putative [Ricinus communis] gi|223535717|gb|EEF37381.1| protoheme IX farnesyltransferase, putative [Ricinus communis] Length = 333 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 ERHRNIDKQARPPVAYASVAPFPFLPVPSYA 93 ERHR+ QARPPVAYASVAPFPFLP PSYA Sbjct: 301 ERHRSASVQARPPVAYASVAPFPFLPAPSYA 331