BLASTX nr result
ID: Jatropha_contig00002610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002610 (384 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518457.1| conserved hypothetical protein [Ricinus comm... 87 2e-15 ref|XP_002317124.1| predicted protein [Populus trichocarpa] gi|5... 64 1e-08 >ref|XP_002518457.1| conserved hypothetical protein [Ricinus communis] gi|223542302|gb|EEF43844.1| conserved hypothetical protein [Ricinus communis] Length = 277 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/64 (59%), Positives = 53/64 (82%) Frame = +3 Query: 189 MVIIYLSGGISKCHPYPGINKIHDASSCKITRVKPLTTIAVSPSLLCLPCNNNVVHNSAL 368 MVI+YLSG I+K HPYPGI+++H+ S C T + +T+ AVSPSLLC+PC NN+V++S++ Sbjct: 1 MVIVYLSGVITKWHPYPGISRLHETSLCNTTHLNSMTSPAVSPSLLCVPC-NNLVYSSSV 59 Query: 369 SWNG 380 SWNG Sbjct: 60 SWNG 63 >ref|XP_002317124.1| predicted protein [Populus trichocarpa] gi|550312418|gb|ERP48503.1| hypothetical protein POPTR_0021s00390g [Populus trichocarpa] Length = 276 Score = 64.3 bits (155), Expect = 1e-08 Identities = 35/64 (54%), Positives = 42/64 (65%) Frame = +3 Query: 189 MVIIYLSGGISKCHPYPGINKIHDASSCKITRVKPLTTIAVSPSLLCLPCNNNVVHNSAL 368 M IY SG ISKC Y G+N HDAS CKIT V L T A SP ++C PC +NV ++S + Sbjct: 1 MGTIYPSGIISKCSAYLGVNTHHDASFCKITYVNTLRT-AFSPRIVCGPC-SNVANDSTI 58 Query: 369 SWNG 380 SW G Sbjct: 59 SWKG 62