BLASTX nr result
ID: Jatropha_contig00002339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002339 (355 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21459.3| unnamed protein product [Vitis vinifera] 66 4e-09 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 60 4e-07 ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 58 1e-06 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 97 RAIRTRTVDLLGKTDQTDYYQNDSNFFKDPTC 2 RAIRTRTVDLLGKTDQTDYYQND N FKDPTC Sbjct: 38 RAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTC 69 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 88 RTRTVDLLGKTDQTDYYQNDSNFFKDPTC 2 R RTVDLLGKTDQTDYY+NDSN FKDPTC Sbjct: 10 RIRTVDLLGKTDQTDYYRNDSNCFKDPTC 38 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 97 RAIRTRTVDLLGKTDQTDYYQNDSNFFKDPTC 2 RAIRTRTVDLLGKT++T YY+ND N FKDPTC Sbjct: 57 RAIRTRTVDLLGKTEKTYYYRNDLNCFKDPTC 88