BLASTX nr result
ID: Jatropha_contig00002318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002318 (333 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus ... 77 3e-12 ref|XP_002301809.1| predicted protein [Populus trichocarpa] gi|2... 76 4e-12 gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus... 74 2e-11 gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus cl... 73 4e-11 ref|XP_003520990.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 73 4e-11 ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus ... 72 9e-11 gb|ACU23964.1| unknown [Glycine max] 71 2e-10 gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao] 69 6e-10 ref|XP_002268161.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 68 1e-09 ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase ... 68 1e-09 ref|XP_003547780.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 67 2e-09 gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus pe... 67 3e-09 gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Ambore... 66 5e-09 ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 1e-08 ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago t... 64 1e-08 gb|AFK35673.1| unknown [Medicago truncatula] 63 3e-08 gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus cl... 63 4e-08 dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] 63 4e-08 gb|ABK24451.1| unknown [Picea sitchensis] 62 6e-08 ref|XP_004975324.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 60 2e-07 >ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] Length = 574 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEES 208 Y+TLK+KMRE NKKEAKFYGNMFAKMNKLGPLDSN S+S E+ Sbjct: 524 YRTLKDKMRELNKKEAKFYGNMFAKMNKLGPLDSNNSKSNEA 565 >ref|XP_002301809.1| predicted protein [Populus trichocarpa] gi|222843535|gb|EEE81082.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa] Length = 575 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/44 (75%), Positives = 43/44 (97%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 +KTLKEKM+EYNKKEAKFYGNMFAKM+K+G L+SNK+E++E++P Sbjct: 525 HKTLKEKMKEYNKKEAKFYGNMFAKMSKVGSLESNKAEAKEAEP 568 >gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris] Length = 574 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEKM+EYNKK+AKFYGNMF K++KL LD+NK+ES+++QP Sbjct: 524 YKTLKEKMKEYNKKQAKFYGNMFNKLHKLDSLDNNKAESKDAQP 567 >gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus clementina] Length = 572 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEKM+EYNKKEAKFYGNMFAKM+ G +SNK+E +E++P Sbjct: 522 YKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESNKAEPKEAEP 565 >ref|XP_003520990.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Length = 470 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEKM+EYNKKEAKFYGNMF K++KL LDSNK S+++QP Sbjct: 420 YKTLKEKMKEYNKKEAKFYGNMFNKLHKLDSLDSNKPASKDAQP 463 >ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223525436|gb|EEF28026.1| peptidylprolyl isomerase, putative [Ricinus communis] Length = 583 Score = 71.6 bits (174), Expect = 9e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKS 223 Y+TLK+KMRE NKKEAKFYGNMFAKMNKLGPLDSN S Sbjct: 524 YRTLKDKMRELNKKEAKFYGNMFAKMNKLGPLDSNVS 560 >gb|ACU23964.1| unknown [Glycine max] Length = 235 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEKM+EYNKKEAKFYG+MF K++KL LDSNK S+++QP Sbjct: 185 YKTLKEKMKEYNKKEAKFYGDMFNKLHKLDSLDSNKPASKDAQP 228 >gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao] Length = 573 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YK LKEKM+EYNKKE+KFYGNMFAKM K+ +DS+KS ++E +P Sbjct: 523 YKVLKEKMKEYNKKESKFYGNMFAKMKKMESIDSSKSAAKEPEP 566 >ref|XP_002268161.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like, partial [Vitis vinifera] gi|296090691|emb|CBI41091.3| unnamed protein product [Vitis vinifera] Length = 342 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 Y+TLKEKM+EYNKKEAKFYGNMFA+MNKL L++NK+ ++E++P Sbjct: 293 YRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETNKA-TKEAEP 335 >ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera] gi|296085741|emb|CBI29552.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 Y+TLKEKM+EYNKKEAKFYGNMFA+MNKL L++NK+ ++E++P Sbjct: 522 YRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETNKA-TKEAEP 564 >ref|XP_003547780.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Length = 574 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 Y TLKEKM+EYNKKEAKFYGNMF K++KL LD++K S+++QP Sbjct: 524 YVTLKEKMKEYNKKEAKFYGNMFNKLHKLDSLDNSKPASKDAQP 567 >gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica] Length = 572 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEKM+E+NKKEAKFYGNMFAK+ K DSNK+ +++++P Sbjct: 522 YKTLKEKMKEFNKKEAKFYGNMFAKLTKSDSPDSNKTAAKDAEP 565 >gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda] Length = 592 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQPTRE 193 Y+TLKEK++EYNKKEAKFYGNMF++M+KL L+SNK+ S+ E Sbjct: 534 YRTLKEKLKEYNKKEAKFYGNMFSRMSKLEQLESNKANQASSKQEEE 580 >ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cicer arietinum] Length = 577 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YK LKEKM+E NKK+AKFYGNMF+KM KL LD++KS ++++P Sbjct: 527 YKVLKEKMKEINKKDAKFYGNMFSKMKKLDSLDNSKSAPKDAEP 570 >ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355520965|gb|AET01419.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula] Length = 575 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEK++E NKK+AKFYGNMF+KM KL LD NKS ++ +P Sbjct: 525 YKTLKEKVKEINKKDAKFYGNMFSKMTKLDSLDINKSAPKDVEP 568 >gb|AFK35673.1| unknown [Medicago truncatula] Length = 575 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YKTLKEK++E NKK+AKFYGNMF+KM KL LD NKS ++ +P Sbjct: 525 YKTLKEKVKEINKKDAKFYGNMFSKMTKLDFLDINKSAPKDVEP 568 >gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus clementina] Length = 559 Score = 62.8 bits (151), Expect = 4e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSN 229 YKTLKEKM+EYNKKEAKFYGNMFAKM+ G +SN Sbjct: 522 YKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSAESN 556 >dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Length = 573 Score = 62.8 bits (151), Expect = 4e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEESQP 202 YK LK+K++E+NKK+AKFYGNMFAK+NKL +S+KS +E +P Sbjct: 523 YKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKSAPKEPEP 566 >gb|ABK24451.1| unknown [Picea sitchensis] Length = 578 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSESEE 211 Y+ LKEK +EYNKKEAKFYGNMFA+M+KL L+S KS S++ Sbjct: 518 YRALKEKQKEYNKKEAKFYGNMFARMSKLEELESRKSGSQK 558 >ref|XP_004975324.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria italica] Length = 594 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 333 YKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNK-SESEESQP 202 YKTLKEKMREYN+++AKFYGNMFAK KL +D+ K +E QP Sbjct: 543 YKTLKEKMREYNRRDAKFYGNMFAKWRKLEHMDTKKVPGKQEPQP 587