BLASTX nr result
ID: Jatropha_contig00002251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002251 (574 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 87 7e-19 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 88 1e-15 tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea m... 58 2e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 86.7 bits (213), Expect(2) = 7e-19 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +1 Query: 13 MAKLVDATDLIGLSLGMETY*VITFKFRETLELKMGNPEPNPVFRKQ 153 MA+LVDATDLIGLSLGMETY V TFKFRETLELKMGNPEPNP FRKQ Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQ 47 Score = 33.1 bits (74), Expect(2) = 7e-19 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 140 FSENKQRFKKTE*KKRIGAETQWKLF 217 F + + ++E KKRIGAETQWKLF Sbjct: 44 FRKQINKSLESENKKRIGAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = +1 Query: 13 MAKLVDATDLIGLSLGMETY*VITFKFRETLELKMGNPEPNPVFRKQ 153 MAKLVDATDLIGLSLGMETY V TFKFRETLELKMGNPEPNP FRKQ Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQ 47 >tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea mays] Length = 73 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 142 KQDLAQDCPFLIPGFL*I*KLSLSKFPYQGSIQLSP 35 K+DLAQDCPF I GFL I KL LS+FPYQGSIQ SP Sbjct: 38 KKDLAQDCPFFIRGFLGIWKLPLSRFPYQGSIQSSP 73