BLASTX nr result
ID: Jatropha_contig00002108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002108 (224 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_022833710.1| sulfate adenylyltransferase subunit 2 [Cytop... 77 2e-16 ref|WP_009939724.1| hypothetical protein, partial [Mycobacterium... 48 2e-07 ref|WP_009202602.1| GCN5-related N-acetyltransferase, partial [A... 55 7e-06 >ref|WP_022833710.1| sulfate adenylyltransferase subunit 2 [Cytophagales str. B6] Length = 300 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 224 LHHSKNWSQSILAENGECANQPLAEHIHRVRHLQQP 117 +HHSKNWSQSILAEN ECANQPLAEHIHRVRHLQQP Sbjct: 248 IHHSKNWSQSILAENCECANQPLAEHIHRVRHLQQP 283 Score = 33.5 bits (75), Expect(2) = 2e-16 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 115 YAAHLGLIRKHLIPIHI 65 +AAHLGLIRK +IPIHI Sbjct: 284 HAAHLGLIRKQIIPIHI 300 >ref|WP_009939724.1| hypothetical protein, partial [Mycobacterium tuberculosis] Length = 36 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +1 Query: 160 GWFAHSPFSARIDWLQFLEW 219 GWFAHS FSARIDWLQFLEW Sbjct: 17 GWFAHSQFSARIDWLQFLEW 36 Score = 32.7 bits (73), Expect(2) = 2e-07 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 117 RLLEMADAMDMFCQ 158 RLLEMADAMDMFCQ Sbjct: 3 RLLEMADAMDMFCQ 16 >ref|WP_009202602.1| GCN5-related N-acetyltransferase, partial [Anaerobaculum hydrogeniformans] gi|289502273|gb|EFD23437.1| hypothetical protein HMPREF1705_02435, partial [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length = 63 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 194 ILAENGECANQPLAEHIHRVRHLQQP 117 ILAEN ECANQPLAEHIHRVRHLQQP Sbjct: 1 ILAENCECANQPLAEHIHRVRHLQQP 26