BLASTX nr result
ID: Jatropha_contig00002064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002064 (149 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA41034.1| delta12-fatty acid desaturase [Jatropha curcas] 56 1e-07 gb|AEW43690.1| fatty acid desaturase 2 [Jatropha curcas] 56 1e-07 gb|ADB93805.1| delta-12-fatty acid desaturase [Jatropha curcas] 56 1e-07 >gb|ABA41034.1| delta12-fatty acid desaturase [Jatropha curcas] Length = 383 Score = 56.2 bits (134), Expect(2) = 1e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -2 Query: 112 KAMWREAKEGIYVNQMMADQSRGVFWYKNKF 20 KAMWREAKE IYV ADQSRGVFWYKNKF Sbjct: 353 KAMWREAKECIYVEPDDADQSRGVFWYKNKF 383 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 147 EYYQFDRTP 121 EYYQFDRTP Sbjct: 342 EYYQFDRTP 350 >gb|AEW43690.1| fatty acid desaturase 2 [Jatropha curcas] Length = 383 Score = 56.2 bits (134), Expect(2) = 1e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -2 Query: 112 KAMWREAKEGIYVNQMMADQSRGVFWYKNKF 20 KAMWREAKE IYV ADQSRGVFWYKNKF Sbjct: 353 KAMWREAKECIYVEPDDADQSRGVFWYKNKF 383 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 147 EYYQFDRTP 121 EYYQFDRTP Sbjct: 342 EYYQFDRTP 350 >gb|ADB93805.1| delta-12-fatty acid desaturase [Jatropha curcas] Length = 383 Score = 56.2 bits (134), Expect(2) = 1e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -2 Query: 112 KAMWREAKEGIYVNQMMADQSRGVFWYKNKF 20 KAMWREAKE IYV ADQSRGVFWYKNKF Sbjct: 353 KAMWREAKECIYVEPDDADQSRGVFWYKNKF 383 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 147 EYYQFDRTP 121 EYYQFDRTP Sbjct: 342 EYYQFDRTP 350