BLASTX nr result
ID: Jatropha_contig00002045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002045 (465 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527184.1| conserved hypothetical protein [Ricinus comm... 91 1e-16 ref|XP_003633077.1| PREDICTED: actin-related protein 6 isoform 2... 91 2e-16 ref|XP_003522641.1| PREDICTED: actin-related protein 6-like isof... 91 2e-16 ref|XP_003522640.1| PREDICTED: actin-related protein 6-like isof... 91 2e-16 ref|XP_002285295.1| PREDICTED: actin-related protein 6 isoform 1... 91 2e-16 ref|XP_002324643.1| actin related protein [Populus trichocarpa] ... 91 2e-16 gb|ABK95736.1| unknown [Populus trichocarpa] gi|550318623|gb|ERP... 91 2e-16 ref|XP_003525911.1| PREDICTED: LOW QUALITY PROTEIN: actin-relate... 90 3e-16 gb|ESW25818.1| hypothetical protein PHAVU_003G068000g [Phaseolus... 89 4e-16 gb|ESQ29853.1| hypothetical protein EUTSA_v10011531mg [Eutrema s... 89 4e-16 ref|XP_004952025.1| PREDICTED: actin-related protein 6-like [Set... 89 4e-16 gb|ABA18108.1| actin-related protein 6 [Arabidopsis arenosa] 89 4e-16 gb|ABA18103.1| actin-related protein 6 [Capsella rubella] 89 4e-16 ref|XP_002877249.1| hypothetical protein ARALYDRAFT_484760 [Arab... 89 4e-16 gb|AAK92721.1| putative actin protein [Arabidopsis thaliana] 89 4e-16 gb|AAF03459.1|AC009992_1 putative actin [Arabidopsis thaliana] 89 4e-16 ref|NP_566861.1| actin-related protein 6 [Arabidopsis thaliana] ... 89 4e-16 gb|AAM53246.1|AF507914_1 actin-related protein 6 [Arabidopsis th... 89 4e-16 ref|XP_006338169.1| PREDICTED: actin-related protein 6-like [Sol... 88 1e-15 ref|XP_004239283.1| PREDICTED: actin-related protein 6-like [Sol... 88 1e-15 >ref|XP_002527184.1| conserved hypothetical protein [Ricinus communis] gi|223533449|gb|EEF35197.1| conserved hypothetical protein [Ricinus communis] Length = 449 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 P+LGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH Sbjct: 408 PLLGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 449 >ref|XP_003633077.1| PREDICTED: actin-related protein 6 isoform 2 [Vitis vinifera] Length = 385 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCR+RFFH Sbjct: 344 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 385 >ref|XP_003522641.1| PREDICTED: actin-related protein 6-like isoform 2 [Glycine max] Length = 434 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCR+RFFH Sbjct: 393 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 434 >ref|XP_003522640.1| PREDICTED: actin-related protein 6-like isoform 1 [Glycine max] Length = 436 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCR+RFFH Sbjct: 395 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 436 >ref|XP_002285295.1| PREDICTED: actin-related protein 6 isoform 1 [Vitis vinifera] gi|297738970|emb|CBI28215.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCR+RFFH Sbjct: 392 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 433 >ref|XP_002324643.1| actin related protein [Populus trichocarpa] gi|222866077|gb|EEF03208.1| Actin-related family protein [Populus trichocarpa] Length = 375 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTK+EYEELGSARCRRRFFH Sbjct: 334 PILGVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRRRFFH 375 >gb|ABK95736.1| unknown [Populus trichocarpa] gi|550318623|gb|ERP49957.1| hypothetical protein POPTR_0018s12840g [Populus trichocarpa] Length = 424 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTK+EYEELGSARCRRRFFH Sbjct: 383 PILGVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRRRFFH 424 >ref|XP_003525911.1| PREDICTED: LOW QUALITY PROTEIN: actin-related protein 6-like [Glycine max] Length = 348 Score = 89.7 bits (221), Expect = 3e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 P+LGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCR+RFFH Sbjct: 307 PLLGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 348 >gb|ESW25818.1| hypothetical protein PHAVU_003G068000g [Phaseolus vulgaris] Length = 435 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFEAMCVTK+EYEELGSARCR+RFFH Sbjct: 394 PILGVWRGGSLLASSPDFEAMCVTKAEYEELGSARCRKRFFH 435 >gb|ESQ29853.1| hypothetical protein EUTSA_v10011531mg [Eutrema salsugineum] Length = 410 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 369 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 410 >ref|XP_004952025.1| PREDICTED: actin-related protein 6-like [Setaria italica] Length = 430 Score = 89.4 bits (220), Expect = 4e-16 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 460 SPILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 +PILGVWRGGS+LASSPDFE+MCVTKSEYEE+GSARCRRRFFH Sbjct: 388 NPILGVWRGGSILASSPDFESMCVTKSEYEEMGSARCRRRFFH 430 >gb|ABA18108.1| actin-related protein 6 [Arabidopsis arenosa] Length = 420 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 379 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 420 >gb|ABA18103.1| actin-related protein 6 [Capsella rubella] Length = 423 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 382 PILGVWRGGSLLASSPDFESMCVTKTEYEELGSARCRRRFFH 423 >ref|XP_002877249.1| hypothetical protein ARALYDRAFT_484760 [Arabidopsis lyrata subsp. lyrata] gi|297323087|gb|EFH53508.1| hypothetical protein ARALYDRAFT_484760 [Arabidopsis lyrata subsp. lyrata] Length = 420 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 379 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 420 >gb|AAK92721.1| putative actin protein [Arabidopsis thaliana] Length = 421 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 380 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 421 >gb|AAF03459.1|AC009992_1 putative actin [Arabidopsis thaliana] Length = 378 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 337 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 378 >ref|NP_566861.1| actin-related protein 6 [Arabidopsis thaliana] gi|75301409|sp|Q8LGE3.1|ARP6_ARATH RecName: Full=Actin-related protein 6; AltName: Full=Protein EARLY IN SHORT DAYS 1; AltName: Full=Protein SUPPRESSOR OF FRIGIDA 3 gi|21489924|tpg|DAA00030.1| TPA_exp: actin-related protein 6; AtARP6 [Arabidopsis thaliana] gi|21536575|gb|AAM60907.1| putative actin [Arabidopsis thaliana] gi|23297435|gb|AAN12968.1| putative actin [Arabidopsis thaliana] gi|332644195|gb|AEE77716.1| actin-related protein 6 [Arabidopsis thaliana] Length = 421 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 380 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 421 >gb|AAM53246.1|AF507914_1 actin-related protein 6 [Arabidopsis thaliana] Length = 422 Score = 89.4 bits (220), Expect = 4e-16 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDFE+MCVTK+EYEELGSARCRRRFFH Sbjct: 381 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 422 >ref|XP_006338169.1| PREDICTED: actin-related protein 6-like [Solanum tuberosum] Length = 438 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDF+AMC+TK+EYEELGSARCR+RFFH Sbjct: 397 PILGVWRGGSLLASSPDFDAMCITKAEYEELGSARCRKRFFH 438 >ref|XP_004239283.1| PREDICTED: actin-related protein 6-like [Solanum lycopersicum] Length = 438 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -3 Query: 457 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRRRFFH 332 PILGVWRGGSLLASSPDF+AMC+TK+EYEELGSARCR+RFFH Sbjct: 397 PILGVWRGGSLLASSPDFDAMCITKAEYEELGSARCRKRFFH 438