BLASTX nr result
ID: Jatropha_contig00002041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00002041 (222 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525009.1| protoheme IX farnesyltransferase, putative [... 70 4e-10 gb|EOY05450.1| Cytochrome c oxidase 10 [Theobroma cacao] 57 3e-06 >ref|XP_002525009.1| protoheme IX farnesyltransferase, putative [Ricinus communis] gi|223535717|gb|EEF37381.1| protoheme IX farnesyltransferase, putative [Ricinus communis] Length = 333 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 7 SGHDNQKSKERHRNIDKQARPPVAYASVAPFPFLPVPSYA 126 SG+D++K+KERHR+ QARPPVAYASVAPFPFLP PSYA Sbjct: 292 SGNDDRKTKERHRSASVQARPPVAYASVAPFPFLPAPSYA 331 >gb|EOY05450.1| Cytochrome c oxidase 10 [Theobroma cacao] Length = 441 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +1 Query: 4 DSGHDNQKSKERHRNIDKQARPPVAYASVAPFPFLPVP 117 D D+QK K RH QARPPVAYAS+APFPFLPVP Sbjct: 402 DVSEDDQKKKTRHFTGGPQARPPVAYASIAPFPFLPVP 439