BLASTX nr result
ID: Jatropha_contig00001942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001942 (566 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39039.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|YP_001152142.1| ORF55b [Pinus koraiensis] gi|145048771|gb|AB... 67 4e-09 ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp.... 60 2e-08 ref|YP_008145821.1| cytochrome b6 (chloroplast) [Glycine stenoph... 64 3e-08 ref|YP_008145373.1| cytochrome b6 (chloroplast) [Glycine tomente... 64 3e-08 ref|YP_538795.1| cytochrome b6 [Glycine max] gi|526175922|ref|YP... 64 3e-08 gb|AAZ04011.1| cytochrome b6 [Nuphar advena] 64 3e-08 ref|YP_053184.1| cytochrome b6 [Nymphaea alba] gi|61212577|sp|Q6... 64 3e-08 gb|AFU96011.1| PetB, partial (chloroplast) [Trigonia sp. CCD-2012] 64 3e-08 gb|AFU95974.1| PetB, partial (chloroplast) [Casearia nitida] 64 3e-08 gb|AEP94890.1| cytochrome b6 [Vigna unguiculata] 64 3e-08 ref|YP_005097904.1| cytochrome b6 (chloroplast) [Colocasia escul... 64 3e-08 gb|ADD31092.1| cytochrome b6 protein [Gunnera manicata] 64 3e-08 ref|YP_002720142.1| petB [Jatropha curcas] gi|326909422|ref|YP_0... 64 3e-08 ref|YP_002456455.1| cytochrome b6 [Trifolium subterraneum] gi|19... 64 3e-08 ref|YP_001122836.2| cytochrome b6 [Phaseolus vulgaris] gi|289066... 64 3e-08 ref|YP_001001564.1| cytochrome b6 [Nuphar advena] gi|84682234|gb... 64 3e-08 ref|YP_784503.1| cytochrome b6 [Piper cenocladum] gi|122164332|s... 64 3e-08 ref|NP_084827.1| cytochrome b6 [Lotus japonicus] gi|23813953|sp|... 64 3e-08 gb|AFU96007.1| PetB, partial (chloroplast) [Quiina glaziovii] 62 7e-08 >emb|CBI39039.3| unnamed protein product [Vitis vinifera] Length = 199 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 124 IIYILYKGPEIPCLRIIEKCININTAVRRGNTK 26 +IY+LYKGPEIPCLRII KCININTAVRRGNTK Sbjct: 1 MIYLLYKGPEIPCLRIIGKCININTAVRRGNTK 33 >ref|YP_001152142.1| ORF55b [Pinus koraiensis] gi|145048771|gb|ABP35389.1| ORF55b [Pinus koraiensis] Length = 55 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 121 IYILYKGPEIPCLRIIEKCININTAVRRGNTKVCK 17 I+ LYKGPEIPCLRII+KCI INTAVRRGN KVCK Sbjct: 20 IFPLYKGPEIPCLRIIKKCIGINTAVRRGNMKVCK 54 >ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297334222|gb|EFH64640.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 50 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 462 DHRKDSLQANQPILCMGLSQWLEQRHIWL 376 DHRKDSL+ NQPI CMGL+QWLEQRHIWL Sbjct: 22 DHRKDSLKVNQPIPCMGLTQWLEQRHIWL 50 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 517 HHLFYWVLRSLFMH 476 H L YW+LRS +H Sbjct: 3 HPLIYWILRSPLIH 16 >ref|YP_008145821.1| cytochrome b6 (chloroplast) [Glycine stenophita] gi|514253093|gb|AGO44352.1| cytochrome b6 (chloroplast) [Glycine stenophita] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_008145373.1| cytochrome b6 (chloroplast) [Glycine tomentella] gi|526176093|ref|YP_008145903.1| cytochrome b6 (chloroplast) [Glycine canescens] gi|526176180|ref|YP_008145985.1| cytochrome b6 (chloroplast) [Glycine dolichocarpa] gi|526176267|ref|YP_008146067.1| cytochrome b6 (chloroplast) [Glycine falcata] gi|526176361|ref|YP_008146149.1| cytochrome b6 (chloroplast) [Glycine syndetika] gi|514253010|gb|AGO44270.1| cytochrome b6 (chloroplast) [Glycine tomentella] gi|514253176|gb|AGO44434.1| cytochrome b6 (chloroplast) [Glycine canescens] gi|514253259|gb|AGO44516.1| cytochrome b6 (chloroplast) [Glycine dolichocarpa] gi|514253342|gb|AGO44598.1| cytochrome b6 (chloroplast) [Glycine falcata] gi|514253425|gb|AGO44680.1| cytochrome b6 (chloroplast) [Glycine syndetika] gi|514253506|gb|AGO44760.1| cytochrome b6 (chloroplast) [Glycine tomentella] gi|514253584|gb|AGO44837.1| cytochrome b6 (chloroplast) [Glycine tomentella] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_538795.1| cytochrome b6 [Glycine max] gi|526175922|ref|YP_008145740.1| cytochrome b6 (chloroplast) [Glycine cyrtoloba] gi|558604166|ref|YP_008816276.1| cytochrome b6 (chloroplast) [Glycine soja] gi|122202480|sp|Q2PMQ5.1|CYB6_SOYBN RecName: Full=Cytochrome b6 gi|83595772|gb|ABC25153.1| cytochrome b6 [Glycine max] gi|514252928|gb|AGO44189.1| cytochrome b6 (chloroplast) [Glycine cyrtoloba] gi|557469758|gb|AHA04011.1| cytochrome b6 (chloroplast) [Glycine soja] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >gb|AAZ04011.1| cytochrome b6 [Nuphar advena] Length = 213 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 182 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 213 >ref|YP_053184.1| cytochrome b6 [Nymphaea alba] gi|61212577|sp|Q6EW22.1|CYB6_NYMAL RecName: Full=Cytochrome b6 gi|50250358|emb|CAF28624.1| cytochrome B6 [Nymphaea alba] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >gb|AFU96011.1| PetB, partial (chloroplast) [Trigonia sp. CCD-2012] Length = 213 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 182 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 213 >gb|AFU95974.1| PetB, partial (chloroplast) [Casearia nitida] Length = 213 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 182 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 213 >gb|AEP94890.1| cytochrome b6 [Vigna unguiculata] Length = 216 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 185 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 216 >ref|YP_005097904.1| cytochrome b6 (chloroplast) [Colocasia esculenta] gi|340536670|gb|AEK48437.1| cytochrome b6 (chloroplast) [Colocasia esculenta] gi|340536757|gb|AEK48523.1| cytochrome b6 (chloroplast) [Colocasia esculenta] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >gb|ADD31092.1| cytochrome b6 protein [Gunnera manicata] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_002720142.1| petB [Jatropha curcas] gi|326909422|ref|YP_004327692.1| cytochrome b6 [Hevea brasiliensis] gi|511348366|ref|YP_008081295.1| cytochrome b6 (chloroplast) [Catharanthus roseus] gi|224979594|gb|ACN72721.1| petB [Jatropha curcas] gi|308523536|gb|ADO33586.1| cytochrome b6 [Hevea brasiliensis] gi|474452106|gb|AGI51174.1| cytochrome b6 (chloroplast) [Catharanthus roseus] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_002456455.1| cytochrome b6 [Trifolium subterraneum] gi|193788939|gb|ACF20535.1| cytochrome b6 [Trifolium subterraneum] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_001122836.2| cytochrome b6 [Phaseolus vulgaris] gi|289066856|ref|YP_003434374.1| cytochrome b6 [Vigna radiata] gi|393396132|ref|YP_006460372.1| cytochrome b6 (chloroplast) [Vigna unguiculata] gi|501594962|ref|YP_007889754.1| cytochrome b6 (chloroplast) [Vigna angularis] gi|145203175|gb|ABH88115.2| cytochrome b6 [Phaseolus vulgaris] gi|158187121|gb|ABW22754.1| cytochrome b6 [Phaseolus vulgaris] gi|259020043|gb|ACV90241.1| cytochrome b6 [Vigna radiata] gi|387598496|gb|AFJ91888.1| cytochrome b6 (chloroplast) [Vigna unguiculata] gi|478620911|dbj|BAN14958.1| cytochrome b6 (chloroplast) [Vigna angularis] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_001001564.1| cytochrome b6 [Nuphar advena] gi|84682234|gb|ABC60488.1| cytochrome b6 [Nuphar advena] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|YP_784503.1| cytochrome b6 [Piper cenocladum] gi|122164332|sp|Q06GN0.1|CYB6_PIPCE RecName: Full=Cytochrome b6 gi|112253780|gb|ABI14501.1| cytochrome b6 [Piper cenocladum] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >ref|NP_084827.1| cytochrome b6 [Lotus japonicus] gi|23813953|sp|Q9BBQ6.1|CYB6_LOTJA RecName: Full=Cytochrome b6 gi|13359009|dbj|BAB33226.1| cytochrome B6 [Lotus japonicus] Length = 215 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLTAVFMLMHFSMIRKQGISGPL Sbjct: 184 YSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 215 >gb|AFU96007.1| PetB, partial (chloroplast) [Quiina glaziovii] Length = 213 Score = 62.4 bits (150), Expect = 7e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 12 FYLHTFVLPLLTAVFMLMHFSMIRKQGISGPL 107 + LHTFVLPLLT+VFMLMHFSMIRKQGISGPL Sbjct: 182 YSLHTFVLPLLTSVFMLMHFSMIRKQGISGPL 213