BLASTX nr result
ID: Jatropha_contig00001859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001859 (468 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004496496.1| PREDICTED: L-type lectin-domain containing r... 50 5e-08 ref|XP_003592149.1| Cysteine-rich receptor-like protein kinase [... 44 3e-06 >ref|XP_004496496.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6-like [Cicer arietinum] Length = 679 Score = 49.7 bits (117), Expect(2) = 5e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 62 RVRIKPILPNDTEKILNVVGDRPNIDDAPYLTHRIQF 172 RVRI+P+ PNDT + NVVGD + D+APYLT R QF Sbjct: 642 RVRIRPVCPNDTPETQNVVGDWLSADEAPYLTPRSQF 678 Score = 32.7 bits (73), Expect(2) = 5e-08 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 3 DAAKILKGEAPLPSLPASKP 62 DAA+++K EAPLP LP SKP Sbjct: 622 DAARMIKKEAPLPLLPQSKP 641 >ref|XP_003592149.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355481197|gb|AES62400.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 666 Score = 44.3 bits (103), Expect(2) = 3e-06 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = +2 Query: 65 VRIKPILPNDTEKILNVVGDRPNIDDAPYLTHRIQF 172 VRI P+ PNDT + +VVGD + D+APYLT R QF Sbjct: 630 VRIMPVCPNDTPETQDVVGDWVSNDEAPYLTPRSQF 665 Score = 32.0 bits (71), Expect(2) = 3e-06 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 Query: 3 DAAKILKGEAPLPSLPASKP 62 DAA+++K EAPLP LP +KP Sbjct: 609 DAARMIKKEAPLPLLPTTKP 628