BLASTX nr result
ID: Jatropha_contig00001851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001851 (492 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 79 1e-26 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 79 2e-21 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 74 3e-20 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 77 4e-19 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 67 2e-18 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 71 3e-18 ref|XP_002329134.1| predicted protein [Populus trichocarpa] 70 1e-17 ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|4... 69 1e-17 dbj|BAD95608.1| metallothionein 3 [Populus alba x Populus glandu... 68 2e-17 gb|ABK96100.1| unknown [Populus trichocarpa] 67 5e-17 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 70 2e-16 gb|AAT02527.1| metallothionein 3b [Populus trichocarpa x Populus... 67 2e-16 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 62 4e-16 emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] 56 8e-16 gb|AGL34968.1| metallothionein type 3 [Coffea arabica] 64 4e-15 gb|AAK08208.1|AF320905_1 metallothionein-like protein [Citrus un... 63 7e-15 gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] 55 1e-14 gb|ABL67648.1| putative metallothionein-like protein [Citrus hyb... 63 1e-14 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 57 1e-14 gb|ACC77568.1| type 3 metallothionein [Prosopis juliflora] 53 2e-14 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 79.3 bits (194), Expect(2) = 1e-26 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP Sbjct: 7 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 43 Score = 66.2 bits (160), Expect(2) = 1e-26 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 253 PAGAENDGKCKCGPSCTCVDCGCGH 327 PAGAENDGKCKCGPSCTCVDCGCGH Sbjct: 43 PAGAENDGKCKCGPSCTCVDCGCGH 67 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 79.0 bits (193), Expect(2) = 2e-21 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADKSQCVKKGSSYTADIVETEKSFVSTI+MDVP Sbjct: 7 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVP 43 Score = 48.9 bits (115), Expect(2) = 2e-21 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCGH 327 AE+DGKCKCG SCTCV C CGH Sbjct: 45 AEHDGKCKCGASCTCVTCTCGH 66 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 74.3 bits (181), Expect(2) = 3e-20 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADKSQCVKKGSSYTAD+VETEKS VSTIVM+VP Sbjct: 7 NCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVP 43 Score = 49.7 bits (117), Expect(2) = 3e-20 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCGH 327 AE+DGKCKCG SCTCV+C CGH Sbjct: 45 AEHDGKCKCGASCTCVNCTCGH 66 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 77.4 bits (189), Expect(2) = 4e-19 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADKSQCVKKGSSYTADIVETEKSFVST+VM+VP Sbjct: 7 NCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVP 43 Score = 42.7 bits (99), Expect(2) = 4e-19 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +1 Query: 265 ENDGKCKCGPSCTCVDCGCGH 327 E DGKC+CG CTC +C CGH Sbjct: 46 EPDGKCRCGAGCTCTNCTCGH 66 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 66.6 bits (161), Expect(2) = 2e-18 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADK+QCVKKGSSYTADI+ETEKS + T+VMD P Sbjct: 7 NCDCADKTQCVKKGSSYTADIIETEKS-IMTVVMDAP 42 Score = 51.6 bits (122), Expect(2) = 2e-18 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCGH 327 AENDGKCKCGPSC+C +C CGH Sbjct: 44 AENDGKCKCGPSCSCTNCTCGH 65 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 70.9 bits (172), Expect(2) = 3e-18 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADK+QCVKKGSSYTADIVETEKS VST VM+VP Sbjct: 7 NCDCADKTQCVKKGSSYTADIVETEKSHVSTGVMEVP 43 Score = 46.6 bits (109), Expect(2) = 3e-18 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 265 ENDGKCKCGPSCTCVDCGCGH 327 ENDGKCKCG +CTC C CGH Sbjct: 46 ENDGKCKCGANCTCTTCTCGH 66 >ref|XP_002329134.1| predicted protein [Populus trichocarpa] Length = 66 Score = 69.7 bits (169), Expect(2) = 1e-17 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADK+QCVKKGSSYTA IVETEK++VS++VM+VP Sbjct: 7 NCDCADKTQCVKKGSSYTAGIVETEKNYVSSVVMEVP 43 Score = 45.8 bits (107), Expect(2) = 1e-17 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCGH 327 AENDGKC CG CTC C CGH Sbjct: 45 AENDGKCNCGTGCTCTTCTCGH 66 >ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|46850189|gb|AAT02526.1| metallothionein 3a [Populus trichocarpa x Populus deltoides] gi|118488217|gb|ABK95928.1| unknown [Populus trichocarpa] gi|118489949|gb|ABK96771.1| unknown [Populus trichocarpa x Populus deltoides] gi|222859959|gb|EEE97506.1| METALLOTHIONEIN 3 family protein [Populus trichocarpa] Length = 66 Score = 68.6 bits (166), Expect(2) = 1e-17 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADK+QCVKKGSSYTADIVETEKS V T VM+VP Sbjct: 7 NCDCADKTQCVKKGSSYTADIVETEKSHVYTGVMEVP 43 Score = 46.6 bits (109), Expect(2) = 1e-17 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 265 ENDGKCKCGPSCTCVDCGCGH 327 ENDGKCKCG +CTC C CGH Sbjct: 46 ENDGKCKCGANCTCTTCTCGH 66 >dbj|BAD95608.1| metallothionein 3 [Populus alba x Populus glandulosa] Length = 66 Score = 68.2 bits (165), Expect(2) = 2e-17 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADK+QCVKKGSSYTA IVETEKS+VST M+VP Sbjct: 7 NCDCADKTQCVKKGSSYTAGIVETEKSYVSTGAMEVP 43 Score = 46.6 bits (109), Expect(2) = 2e-17 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +1 Query: 265 ENDGKCKCGPSCTCVDCGCGH 327 ENDGKCKCG +CTC C CGH Sbjct: 46 ENDGKCKCGANCTCTTCTCGH 66 >gb|ABK96100.1| unknown [Populus trichocarpa] Length = 66 Score = 67.4 bits (163), Expect(2) = 5e-17 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +3 Query: 147 CDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 CDCADK+QCVKKGSSYTA IVETEK++VS++VM+VP Sbjct: 8 CDCADKTQCVKKGSSYTAGIVETEKNYVSSVVMEVP 43 Score = 45.8 bits (107), Expect(2) = 5e-17 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCGH 327 AENDGKC CG CTC C CGH Sbjct: 45 AENDGKCNCGTGCTCTTCTCGH 66 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 69.7 bits (169), Expect(2) = 2e-16 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPGRR*E 269 NCDCADKSQCVKKG+SY DIVETEKS+V+T+VM+VP + E Sbjct: 6 NCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHE 47 Score = 41.6 bits (96), Expect(2) = 2e-16 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCG 324 A+++G CKCG SC C+DC CG Sbjct: 44 AQHEGSCKCGDSCACIDCTCG 64 >gb|AAT02527.1| metallothionein 3b [Populus trichocarpa x Populus deltoides] Length = 66 Score = 67.0 bits (162), Expect(2) = 2e-16 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 147 CDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 CDCADK+QCVKKGSSYTA IVETEK++VS +VM+VP Sbjct: 8 CDCADKTQCVKKGSSYTAGIVETEKNYVSAVVMEVP 43 Score = 44.3 bits (103), Expect(2) = 2e-16 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 265 ENDGKCKCGPSCTCVDCGCGH 327 ENDGKC CG CTC C CGH Sbjct: 46 ENDGKCNCGTGCTCTTCTCGH 66 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 61.6 bits (148), Expect(2) = 4e-16 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADKSQCVKKG+ YT +I+ETEKSF V +VP Sbjct: 6 NCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVP 42 Score = 48.5 bits (114), Expect(2) = 4e-16 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCG 324 AE+DGKCKCG SCTCVDC CG Sbjct: 44 AEHDGKCKCGSSCTCVDCTCG 64 >emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] Length = 65 Score = 55.8 bits (133), Expect(2) = 8e-16 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDV 251 NCDCADK+ C KKG+SY DI+ET+KS+ +VMDV Sbjct: 6 NCDCADKTNCPKKGNSYGFDIIETQKSYDDVVVMDV 41 Score = 53.1 bits (126), Expect(2) = 8e-16 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCGH 327 AENDGKCKCGPSC+CV C CGH Sbjct: 44 AENDGKCKCGPSCSCVGCSCGH 65 >gb|AGL34968.1| metallothionein type 3 [Coffea arabica] Length = 65 Score = 63.5 bits (153), Expect(2) = 4e-15 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVM 245 NCDCAD+SQCVKKGSSY ADIVETE +FV T VM Sbjct: 7 NCDCADRSQCVKKGSSYAADIVETENTFVETFVM 40 Score = 43.1 bits (100), Expect(2) = 4e-15 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 247 MFPAGAENDGKCKCGPSCTCVDCGC 321 M GA+N GKCKCGPSC CV+C C Sbjct: 40 MMEGGAQN-GKCKCGPSCACVNCTC 63 >gb|AAK08208.1|AF320905_1 metallothionein-like protein [Citrus unshiu] gi|12830832|gb|AAK08209.1|AF320906_1 metallothionein-like protein [Citrus unshiu] gi|3308982|dbj|BAA31562.1| metallothionein-like protein [Citrus unshiu] gi|158936952|dbj|BAF91493.1| metallothionein type 3 [Citrus unshiu] Length = 68 Score = 63.2 bits (152), Expect(2) = 7e-15 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVST-IVMDV 251 NCDCAD+SQCVKKGSSY AD VET+ SFVST +VMDV Sbjct: 7 NCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDV 43 Score = 42.7 bits (99), Expect(2) = 7e-15 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCG 324 AE +G CKCGP+C CV+C CG Sbjct: 46 AETEGNCKCGPTCACVNCTCG 66 >gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] Length = 63 Score = 54.7 bits (130), Expect(2) = 1e-14 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 253 PAGAENDGKCKCGPSCTCVDCGCGH 327 PA AENDGKCKCG SC+C DC CGH Sbjct: 39 PAAAENDGKCKCGSSCSCTDCTCGH 63 Score = 50.4 bits (119), Expect(2) = 1e-14 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 +CDCADKSQC K G YTADI+ETEKS+ +VMD P Sbjct: 7 SCDCADKSQCGKNG--YTADIIETEKSY--AMVMDAP 39 >gb|ABL67648.1| putative metallothionein-like protein [Citrus hybrid cultivar] Length = 68 Score = 63.2 bits (152), Expect(2) = 1e-14 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVST-IVMDV 251 NCDCAD+SQCVKKGSSY AD VET+ SFVST +VMDV Sbjct: 7 NCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDV 43 Score = 42.0 bits (97), Expect(2) = 1e-14 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 262 AENDGKCKCGPSCTCVDCGCG 324 AE +G CKCGP+C CV+C CG Sbjct: 46 AEAEGNCKCGPTCACVNCTCG 66 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 57.0 bits (136), Expect(2) = 1e-14 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVP 254 NCDCADK+QCVK G+ Y DIVETEK V T+VM+VP Sbjct: 7 NCDCADKTQCVK-GNKYGVDIVETEKRMVETVVMEVP 42 Score = 47.8 bits (112), Expect(2) = 1e-14 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +1 Query: 253 PAGAENDGKCKCGPSCTCVDCGCGH 327 PAG ENDGKCKCG +C+C +C CGH Sbjct: 42 PAG-ENDGKCKCGANCSCTNCTCGH 65 >gb|ACC77568.1| type 3 metallothionein [Prosopis juliflora] Length = 67 Score = 53.1 bits (126), Expect(2) = 2e-14 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +1 Query: 256 AGAENDGKCKCGPSCTCVDCGCGH 327 A E+DGKCKCGPSC+CVDC CGH Sbjct: 44 AAGEHDGKCKCGPSCSCVDCTCGH 67 Score = 51.2 bits (121), Expect(2) = 2e-14 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +3 Query: 144 NCDCADKSQCVKKGSSYTADIVETEKSFVSTIVM 245 NCDCADKSQCVKKG+ Y ADI++ + S+ + +M Sbjct: 7 NCDCADKSQCVKKGNGYVADIIDPDNSYDESYMM 40