BLASTX nr result
ID: Jatropha_contig00001806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001806 (354 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529905.1| gaba(A) receptor-associated protein, putativ... 90 3e-16 gb|ESW04535.1| hypothetical protein PHAVU_011G103300g [Phaseolus... 87 2e-15 ref|XP_004487416.1| PREDICTED: autophagy-related protein 8d-like... 87 2e-15 ref|XP_004487415.1| PREDICTED: autophagy-related protein 8d-like... 87 2e-15 ref|NP_001237805.1| uncharacterized protein LOC100500165 [Glycin... 87 2e-15 ref|NP_001235975.1| ATG8d protein [Glycine max] gi|223019809|dbj... 87 2e-15 gb|ESR65626.1| hypothetical protein CICLE_v10009926mg [Citrus cl... 87 2e-15 ref|XP_004515097.1| PREDICTED: autophagy-related protein 8d-like... 87 3e-15 gb|AFK43401.1| unknown [Lotus japonicus] 87 3e-15 gb|AFK37133.1| unknown [Medicago truncatula] 87 3e-15 gb|EPS63017.1| autophagy 8a, partial [Genlisea aurea] 86 4e-15 ref|XP_003596976.1| Autophagy-related protein 8B [Medicago trunc... 86 4e-15 ref|XP_003596975.1| Autophagy-related protein 8B [Medicago trunc... 86 4e-15 ref|XP_002279682.1| PREDICTED: autophagy-related protein 8C isof... 86 4e-15 ref|XP_002529904.1| gaba(A) receptor-associated protein, putativ... 86 4e-15 gb|ACJ84082.1| unknown [Medicago truncatula] gi|388498482|gb|AFK... 86 4e-15 ref|XP_002302875.1| predicted protein [Populus trichocarpa] gi|1... 86 4e-15 ref|XP_002279664.1| PREDICTED: autophagy-related protein 8C isof... 86 4e-15 gb|EOY01491.1| Ubiquitin-like superfamily protein [Theobroma cacao] 86 5e-15 ref|XP_004294436.1| PREDICTED: autophagy-related protein 8C-like... 86 5e-15 >ref|XP_002529905.1| gaba(A) receptor-associated protein, putative [Ricinus communis] gi|223530582|gb|EEF32459.1| gaba(A) receptor-associated protein, putative [Ricinus communis] Length = 125 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGLSMKVQ 144 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG S+++Q Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGASVELQ 123 >gb|ESW04535.1| hypothetical protein PHAVU_011G103300g [Phaseolus vulgaris] gi|561005542|gb|ESW04536.1| hypothetical protein PHAVU_011G103300g [Phaseolus vulgaris] Length = 120 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 118 >ref|XP_004487416.1| PREDICTED: autophagy-related protein 8d-like isoform X2 [Cicer arietinum] Length = 120 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 118 >ref|XP_004487415.1| PREDICTED: autophagy-related protein 8d-like isoform X1 [Cicer arietinum] Length = 134 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL Sbjct: 91 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 132 >ref|NP_001237805.1| uncharacterized protein LOC100500165 [Glycine max] gi|255629510|gb|ACU15101.1| unknown [Glycine max] Length = 120 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 118 >ref|NP_001235975.1| ATG8d protein [Glycine max] gi|223019809|dbj|BAH22449.1| GmATG8d [Glycine max] Length = 120 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 118 >gb|ESR65626.1| hypothetical protein CICLE_v10009926mg [Citrus clementina] gi|557555613|gb|ESR65627.1| hypothetical protein CICLE_v10009926mg [Citrus clementina] gi|557555614|gb|ESR65628.1| hypothetical protein CICLE_v10009926mg [Citrus clementina] gi|557555615|gb|ESR65629.1| hypothetical protein CICLE_v10009926mg [Citrus clementina] gi|557555616|gb|ESR65630.1| hypothetical protein CICLE_v10009926mg [Citrus clementina] Length = 120 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGLS 132 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG S Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGAS 119 >ref|XP_004515097.1| PREDICTED: autophagy-related protein 8d-like isoform X1 [Cicer arietinum] gi|502171765|ref|XP_004515098.1| PREDICTED: autophagy-related protein 8d-like isoform X2 [Cicer arietinum] gi|502171771|ref|XP_004515099.1| PREDICTED: autophagy-related protein 8d-like isoform X3 [Cicer arietinum] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG+ Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGM 118 >gb|AFK43401.1| unknown [Lotus japonicus] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG+ Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGM 118 >gb|AFK37133.1| unknown [Medicago truncatula] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG+ Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGM 118 >gb|EPS63017.1| autophagy 8a, partial [Genlisea aurea] Length = 117 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 126 IFIFV+NVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG Sbjct: 77 IFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117 >ref|XP_003596976.1| Autophagy-related protein 8B [Medicago truncatula] gi|355486024|gb|AES67227.1| Autophagy-related protein 8B [Medicago truncatula] Length = 92 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGLSM 135 IFIFV+N+LPPTA MMSAIYEENKDEDGFLYMTYSGENTFG+ M Sbjct: 49 IFIFVKNILPPTAGMMSAIYEENKDEDGFLYMTYSGENTFGMLM 92 >ref|XP_003596975.1| Autophagy-related protein 8B [Medicago truncatula] gi|355486023|gb|AES67226.1| Autophagy-related protein 8B [Medicago truncatula] Length = 108 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGLSM 135 IFIFV+N+LPPTA MMSAIYEENKDEDGFLYMTYSGENTFG+ M Sbjct: 65 IFIFVKNILPPTAGMMSAIYEENKDEDGFLYMTYSGENTFGMLM 108 >ref|XP_002279682.1| PREDICTED: autophagy-related protein 8C isoform 2 [Vitis vinifera] Length = 125 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 126 IFIFV+NVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG Sbjct: 83 IFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 123 >ref|XP_002529904.1| gaba(A) receptor-associated protein, putative [Ricinus communis] gi|223530581|gb|EEF32458.1| gaba(A) receptor-associated protein, putative [Ricinus communis] Length = 120 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGLS 132 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG S Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGES 119 >gb|ACJ84082.1| unknown [Medicago truncatula] gi|388498482|gb|AFK37307.1| unknown [Medicago truncatula] Length = 120 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGLSM 135 IFIFV+N+LPPTA MMSAIYEENKDEDGFLYMTYSGENTFG+ M Sbjct: 77 IFIFVKNILPPTAGMMSAIYEENKDEDGFLYMTYSGENTFGMLM 120 >ref|XP_002302875.1| predicted protein [Populus trichocarpa] gi|118485794|gb|ABK94745.1| unknown [Populus trichocarpa] gi|222844601|gb|EEE82148.1| autophagy 8d family protein [Populus trichocarpa] Length = 121 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGL 129 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG+ Sbjct: 79 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFGV 120 >ref|XP_002279664.1| PREDICTED: autophagy-related protein 8C isoform 1 [Vitis vinifera] gi|297737448|emb|CBI26649.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 126 IFIFV+NVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG Sbjct: 77 IFIFVKNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117 >gb|EOY01491.1| Ubiquitin-like superfamily protein [Theobroma cacao] Length = 200 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 126 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG Sbjct: 153 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 193 >ref|XP_004294436.1| PREDICTED: autophagy-related protein 8C-like isoform 1 [Fragaria vesca subsp. vesca] gi|470116535|ref|XP_004294437.1| PREDICTED: autophagy-related protein 8C-like isoform 2 [Fragaria vesca subsp. vesca] Length = 119 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 4 IFIFVRNVLPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 126 IFIFV+N+LPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG Sbjct: 77 IFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117