BLASTX nr result
ID: Jatropha_contig00001756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001756 (379 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517182.1| conserved hypothetical protein [Ricinus comm... 77 3e-12 ref|XP_002510688.1| conserved hypothetical protein [Ricinus comm... 58 5e-10 ref|XP_002307798.1| predicted protein [Populus trichocarpa] gi|2... 53 3e-08 gb|EOY15291.1| Uncharacterized protein TCM_034405 [Theobroma cacao] 50 1e-06 >ref|XP_002517182.1| conserved hypothetical protein [Ricinus communis] gi|223543817|gb|EEF45345.1| conserved hypothetical protein [Ricinus communis] Length = 244 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/72 (50%), Positives = 57/72 (79%), Gaps = 1/72 (1%) Frame = -3 Query: 374 GPPLIEKARKRHLH*KRDL-CRACEDRS*KNVRFAAYTFLSKDPTKVRAFFGYPVDERKE 198 G +I++AR+ H++ +R++ + +++R+ AYTFL++DP +VRAFFGYPV+ERK+ Sbjct: 174 GNAIIDRARQ-HVYSEREVYAELVKIGLERHLRYTAYTFLTQDPVRVRAFFGYPVNERKD 232 Query: 197 FLIQMMYGPEDP 162 FL+QMMYGP+DP Sbjct: 233 FLLQMMYGPQDP 244 >ref|XP_002510688.1| conserved hypothetical protein [Ricinus communis] gi|223551389|gb|EEF52875.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 57.8 bits (138), Expect(2) = 5e-10 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 290 KNVRFAAYTFLSKDPTKVRAFFGYPVDERKEFLIQMMYGPED 165 +++R+ AYTFL + + RAFFG P +ERKEFL+QMMY PED Sbjct: 279 RHMRYKAYTFLIANAGRARAFFGCPSEERKEFLLQMMYSPED 320 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -1 Query: 340 IYTEREIYAELVKIGVER 287 +Y+E+E++ ELVKIGVER Sbjct: 262 VYSEQEVFTELVKIGVER 279 >ref|XP_002307798.1| predicted protein [Populus trichocarpa] gi|222857247|gb|EEE94794.1| hypothetical protein POPTR_0005s27380g [Populus trichocarpa] Length = 322 Score = 53.1 bits (126), Expect(2) = 3e-08 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -3 Query: 287 NVRFAAYTFLSKDPTKVRAFFGYPVDERKEFLIQMMYGPED 165 ++R+ AYTFL + +VRAFFG P ER+EFL+ MMY P+D Sbjct: 277 HLRYKAYTFLVANSGRVRAFFGCPPGERREFLLHMMYSPDD 317 Score = 30.0 bits (66), Expect(2) = 3e-08 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = -1 Query: 340 IYTEREIYAELVKIGVE 290 +Y+E+E+++ELVKIGVE Sbjct: 259 VYSEQEVFSELVKIGVE 275 >gb|EOY15291.1| Uncharacterized protein TCM_034405 [Theobroma cacao] Length = 209 Score = 50.1 bits (118), Expect(2) = 1e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -3 Query: 284 VRFAAYTFLSKDPTKVRAFFGYPVDERKEFLIQMMYGPED 165 +R AYTFL + +VRA FG P +ERKE+L QMMY ED Sbjct: 167 LRHKAYTFLIANAARVRALFGCPAEERKEYLSQMMYSSED 206 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -1 Query: 343 VIYTEREIYAELVKIGVE 290 V Y+E+E++AELV IGV+ Sbjct: 147 VYYSEQEVFAELVNIGVD 164