BLASTX nr result
ID: Jatropha_contig00001725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001725 (357 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238504.1| uncharacterized protein LOC100499952 precurs... 65 7e-09 gb|ESW16322.1| hypothetical protein PHAVU_007G146800g [Phaseolus... 60 2e-07 gb|ERN19469.1| hypothetical protein AMTR_s00069p00189250 [Ambore... 60 2e-07 gb|EPS70796.1| hypothetical protein M569_03964, partial [Genlise... 60 2e-07 gb|EOY06550.1| Ribosomal L22e protein family isoform 1 [Theobrom... 60 2e-07 ref|XP_004495952.1| PREDICTED: 60S ribosomal protein L22-2-like ... 60 2e-07 ref|XP_004306928.1| PREDICTED: 60S ribosomal protein L22-2-like ... 60 2e-07 ref|XP_004290797.1| PREDICTED: 60S ribosomal protein L22-2-like ... 60 2e-07 gb|EMJ19803.1| hypothetical protein PRUPE_ppa013414mg [Prunus pe... 60 2e-07 ref|XP_004136027.1| PREDICTED: 60S ribosomal protein L22-2-like ... 60 2e-07 emb|CCO66668.1| predicted protein [Bathycoccus prasinos] 60 2e-07 ref|NP_001050078.1| Os03g0343500 [Oryza sativa Japonica Group] g... 60 2e-07 gb|AFK37749.1| unknown [Lotus japonicus] gi|388514599|gb|AFK4536... 60 2e-07 ref|XP_005650530.1| ribosomal protein L22 component of cytosolic... 60 2e-07 ref|XP_002957020.1| component of cytosolic 80S ribosome and 60S ... 60 2e-07 ref|XP_002516939.1| 60S ribosomal protein L22, putative [Ricinus... 60 2e-07 ref|XP_002523090.1| 60S ribosomal protein L22, putative [Ricinus... 60 2e-07 ref|XP_002319510.1| predicted protein [Populus trichocarpa] 60 2e-07 gb|EEE59042.1| hypothetical protein OsJ_10802 [Oryza sativa Japo... 60 2e-07 gb|ACJ83860.1| unknown [Medicago truncatula] 60 2e-07 >ref|NP_001238504.1| uncharacterized protein LOC100499952 precursor [Glycine max] gi|255627947|gb|ACU14318.1| unknown [Glycine max] Length = 146 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = -1 Query: 162 LLFLFTFILSNIEVSQLINITILVGSNDSKPIPHIVLLQVFLGQVLEI 19 L+F +FILSN+EV Q IN +I V SN S+P+PHIVLLQV L QVLE+ Sbjct: 12 LIFFLSFILSNVEVPQFINASIFVRSNHSEPVPHIVLLQVLLSQVLEV 59 >gb|ESW16322.1| hypothetical protein PHAVU_007G146800g [Phaseolus vulgaris] Length = 119 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 85 HNVRDWLRVIASNKDRNVYELRYFNIA 111 >gb|ERN19469.1| hypothetical protein AMTR_s00069p00189250 [Amborella trichopoda] Length = 124 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 90 HNVRDWLRVIASNKDRNVYELRYFNIA 116 >gb|EPS70796.1| hypothetical protein M569_03964, partial [Genlisea aurea] Length = 62 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 28 HNVRDWLRVIASNKDRNVYELRYFNIA 54 >gb|EOY06550.1| Ribosomal L22e protein family isoform 1 [Theobroma cacao] gi|508714654|gb|EOY06551.1| Ribosomal L22e protein family isoform 1 [Theobroma cacao] Length = 125 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 91 HNVRDWLRVIASNKDRNVYELRYFNIA 117 >ref|XP_004495952.1| PREDICTED: 60S ribosomal protein L22-2-like [Cicer arietinum] Length = 119 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 85 HNVRDWLRVIASNKDRNVYELRYFNIA 111 >ref|XP_004306928.1| PREDICTED: 60S ribosomal protein L22-2-like [Fragaria vesca subsp. vesca] Length = 124 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 90 HNVRDWLRVIASNKDRNVYELRYFNIA 116 >ref|XP_004290797.1| PREDICTED: 60S ribosomal protein L22-2-like [Fragaria vesca subsp. vesca] Length = 124 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 90 HNVRDWLRVIASNKDRNVYELRYFNIA 116 >gb|EMJ19803.1| hypothetical protein PRUPE_ppa013414mg [Prunus persica] Length = 124 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 90 HNVRDWLRVIASNKDRNVYELRYFNIA 116 >ref|XP_004136027.1| PREDICTED: 60S ribosomal protein L22-2-like [Cucumis sativus] gi|449498507|ref|XP_004160556.1| PREDICTED: 60S ribosomal protein L22-2-like [Cucumis sativus] Length = 126 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 92 HNVRDWLRVIASNKDRNVYELRYFNIA 118 >emb|CCO66668.1| predicted protein [Bathycoccus prasinos] Length = 120 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 87 HNVRDWLRVIASNKDRNVYELRYFNIA 113 >ref|NP_001050078.1| Os03g0343500 [Oryza sativa Japonica Group] gi|42733478|dbj|BAD11336.1| BRI1-KD interacting protein 108 [Oryza sativa Japonica Group] gi|108708084|gb|ABF95879.1| 60S ribosomal protein L22-2, putative, expressed [Oryza sativa Japonica Group] gi|113548549|dbj|BAF11992.1| Os03g0343500 [Oryza sativa Japonica Group] gi|125543823|gb|EAY89962.1| hypothetical protein OsI_11522 [Oryza sativa Indica Group] gi|215765091|dbj|BAG86788.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765349|dbj|BAG87046.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768292|dbj|BAH00521.1| unnamed protein product [Oryza sativa Japonica Group] Length = 131 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 97 HNVRDWLRVIASNKDRNVYELRYFNIA 123 >gb|AFK37749.1| unknown [Lotus japonicus] gi|388514599|gb|AFK45361.1| unknown [Lotus japonicus] Length = 119 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 85 HNVRDWLRVIASNKDRNVYELRYFNIA 111 >ref|XP_005650530.1| ribosomal protein L22 component of cytosolic 80S ribosome and 60S large subunit [Coccomyxa subellipsoidea C-169] gi|384252510|gb|EIE25986.1| ribosomal protein L22 component of cytosolic 80S ribosome and 60S large subunit [Coccomyxa subellipsoidea C-169] Length = 127 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 93 HNVRDWLRVIASNKDRNVYELRYFNIA 119 >ref|XP_002957020.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox carteri f. nagariensis] gi|300257738|gb|EFJ41983.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox carteri f. nagariensis] Length = 127 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 93 HNVRDWLRVIASNKDRNVYELRYFNIA 119 >ref|XP_002516939.1| 60S ribosomal protein L22, putative [Ricinus communis] gi|223544027|gb|EEF45553.1| 60S ribosomal protein L22, putative [Ricinus communis] Length = 127 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 93 HNVRDWLRVIASNKDRNVYELRYFNIA 119 >ref|XP_002523090.1| 60S ribosomal protein L22, putative [Ricinus communis] gi|223537652|gb|EEF39275.1| 60S ribosomal protein L22, putative [Ricinus communis] Length = 126 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 92 HNVRDWLRVIASNKDRNVYELRYFNIA 118 >ref|XP_002319510.1| predicted protein [Populus trichocarpa] Length = 117 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 83 HNVRDWLRVIASNKDRNVYELRYFNIA 109 >gb|EEE59042.1| hypothetical protein OsJ_10802 [Oryza sativa Japonica Group] Length = 126 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 92 HNVRDWLRVIASNKDRNVYELRYFNIA 118 >gb|ACJ83860.1| unknown [Medicago truncatula] Length = 125 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 55 HNVRDWLRVIASNKDRNVYELRYFNIA 135 HNVRDWLRVIASNKDRNVYELRYFNIA Sbjct: 91 HNVRDWLRVIASNKDRNVYELRYFNIA 117