BLASTX nr result
ID: Jatropha_contig00001724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001724 (435 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus comm... 57 2e-06 >ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus communis] gi|223541011|gb|EEF42569.1| Extensin-3 precursor, putative [Ricinus communis] Length = 830 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 267 GFLGLWGERVDSIDYYKQQIQELEKRVSHDYQ 172 GFL LWGERVDSIDYYKQQIQELEKR++ + Q Sbjct: 277 GFLRLWGERVDSIDYYKQQIQELEKRMAMERQ 308