BLASTX nr result
ID: Jatropha_contig00001722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001722 (529 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN02875.1| hypothetical protein AMTR_s00334p00015220 [Ambore... 78 1e-12 ref|YP_004072463.1| Ycf3 protein [Corynocarpus laevigata] gi|309... 77 2e-12 ref|YP_001671684.1| photosystem I assembly protein Ycf3 [Carica ... 77 3e-12 ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium ... 76 4e-12 ref|NP_084670.3| photosystem I assembly protein Ycf3 [Oenothera ... 76 4e-12 gb|AFU96552.1| Ycf3, partial (chloroplast) [Viola pubescens] 76 4e-12 gb|AFU96550.1| Ycf3, partial (chloroplast) [Scyphostegia borneen... 76 4e-12 gb|AFU96549.1| Ycf3, partial (chloroplast) [Schistostemon retusum] 76 4e-12 gb|AFU96544.1| Ycf3, partial (chloroplast) [Ploiarium sp. CCD-2012] 76 4e-12 gb|AFU96543.1| Ycf3, partial (chloroplast) [Phyllanthus urinaria] 76 4e-12 gb|AFU96536.1| Ycf3, partial (chloroplast) [Linum usitatissimum] 76 4e-12 gb|AFU96533.1| Ycf3, partial (chloroplast) [Irvingia malayana] 76 4e-12 gb|AFU96529.1| Ycf3, partial (chloroplast) [Garcinia mangostana] 76 4e-12 gb|AFU96527.1| Ycf3, partial (chloroplast) [Flueggea suffruticos... 76 4e-12 gb|AFU96526.1| Ycf3, partial (chloroplast) [Euphorbia maculata] 76 4e-12 gb|AFU96524.1| Ycf3, partial (chloroplast) [Elaeodendron orientale] 76 4e-12 gb|AFU96520.1| Ycf3, partial (chloroplast) [Caloncoba echinata] 76 4e-12 gb|AFU96517.1| Ycf3, partial (chloroplast) [Bergia texana] 76 4e-12 ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chlorop... 76 4e-12 ref|YP_005090179.1| ycf3 gene product (chloroplast) [Ricinus com... 76 4e-12 >gb|ERN02875.1| hypothetical protein AMTR_s00334p00015220 [Amborella trichopoda] Length = 70 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = -1 Query: 529 DRGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 DRGEQAIRQGDSEIAEAW + + +ALTPGNYIEAQNWLKITRRFE Sbjct: 20 DRGEQAIRQGDSEIAEAWFD-QAAEYWKQALALTPGNYIEAQNWLKITRRFE 70 >ref|YP_004072463.1| Ycf3 protein [Corynocarpus laevigata] gi|309252891|gb|ADO60311.1| Ycf3 protein [Corynocarpus laevigata] Length = 168 Score = 77.0 bits (188), Expect = 2e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFN-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 168 >ref|YP_001671684.1| photosystem I assembly protein Ycf3 [Carica papaya] gi|166344133|gb|ABY86783.1| photosystem I assembly protein ycf3 [Carica papaya] Length = 168 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFA-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 168 >ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium hirsutum] gi|119368500|ref|YP_913188.1| PSI accumulation protein [Gossypium barbadense] gi|325210931|ref|YP_004286005.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|372290933|ref|YP_005087694.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|372291032|ref|YP_005087790.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|372291386|ref|YP_005088281.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|372291484|ref|YP_005088377.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291774|ref|YP_005088917.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|372291858|ref|YP_005089000.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|386800838|ref|YP_006303492.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|394830627|ref|YP_006503278.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium incanum] gi|394830714|ref|YP_006503361.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium somalense] gi|394830889|ref|YP_006503527.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|394830976|ref|YP_006503610.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium robinsonii] gi|122226162|sp|Q2L906.1|YCF3_GOSHI RecName: Full=Photosystem I assembly protein ycf3 gi|125991253|sp|A0ZZ36.1|YCF3_GOSBA RecName: Full=Photosystem I assembly protein ycf3 gi|85687417|gb|ABC73629.1| photosystem I assembly protein ycf3 [Gossypium hirsutum] gi|119224862|dbj|BAF41248.1| PSI accumulation protein [Gossypium barbadense] gi|290775793|gb|ADD62289.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|318084317|gb|ADV38793.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|318084400|gb|ADV38875.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|318084485|gb|ADV38959.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084569|gb|ADV39042.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|318084651|gb|ADV39123.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|318084737|gb|ADV39208.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|326457128|gb|ADZ74391.1| hypothetical chloroplast RF34 [Gossypium bickii] gi|326457216|gb|ADZ74478.1| hypothetical chloroplast RF34 [Gossypium herbaceum] gi|326457302|gb|ADZ74563.1| hypothetical chloroplast RF34 [Gossypium longicalyx] gi|326457389|gb|ADZ74649.1| hypothetical chloroplast RF34 [Gossypium stocksii] gi|326457477|gb|ADZ74736.1| hypothetical chloroplast RF34 [Gossypium sturtianum] gi|329317072|gb|AEB90431.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|329317156|gb|AEB90514.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317240|gb|AEB90597.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317324|gb|AEB90680.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317408|gb|AEB90763.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317492|gb|AEB90846.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|335354332|gb|AEH42952.1| photosystem I assembly protein Ycf3 [Gossypium incanum] gi|335354416|gb|AEH43035.1| photosystem I assembly protein Ycf3 [Gossypium somalense] gi|335354584|gb|AEH43201.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|335354668|gb|AEH43284.1| photosystem I assembly protein Ycf3 [Gossypium robinsonii] Length = 168 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 168 >ref|NP_084670.3| photosystem I assembly protein Ycf3 [Oenothera elata subsp. hookeri] gi|108802644|ref|YP_636300.1| photosystem I assembly protein Ycf3 [Eucalyptus globulus subsp. globulus] gi|169142700|ref|YP_001687127.1| photosystem I assembly protein Ycf3 [Oenothera argillicola] gi|169142850|ref|YP_001687273.1| photosystem I assembly protein Ycf3 [Oenothera glazioviana] gi|169142935|ref|YP_001687357.1| photosystem I assembly protein Ycf3 [Oenothera biennis] gi|169143021|ref|YP_001687441.1| photosystem I assembly protein Ycf3 [Oenothera parviflora] gi|309322450|ref|YP_003933963.1| hypothetical chloroplast RF34 [Eucalyptus grandis] gi|313199703|ref|YP_004021317.1| hypothetical chloroplast RF34 [Theobroma cacao] gi|501770855|ref|YP_007889862.1| hypothetical chloroplast RF34 [Francoa sonchifolia] gi|545716246|ref|YP_008575114.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus obliqua] gi|545716332|ref|YP_008575199.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus radiata] gi|545716418|ref|YP_008575284.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus delegatensis] gi|545716504|ref|YP_008575369.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus verrucata] gi|545716590|ref|YP_008575454.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus baxteri] gi|545716676|ref|YP_008575539.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversifolia] gi|545716762|ref|YP_008575624.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus sieberi] gi|545716848|ref|YP_008575709.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus elata] gi|545716934|ref|YP_008575794.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus regnans] gi|545717020|ref|YP_008575879.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus umbra] gi|545717106|ref|YP_008575964.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cloeziana] gi|545717192|ref|YP_008576049.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus patens] gi|545717278|ref|YP_008576134.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus marginata] gi|545717364|ref|YP_008576219.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus curtisii] gi|545717450|ref|YP_008576304.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus melliodora] gi|545717536|ref|YP_008576389.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus polybractea] gi|545717622|ref|YP_008576474.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cladocalyx] gi|545717708|ref|YP_008576559.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus nitens] gi|545717794|ref|YP_008576644.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus aromaphloia] gi|545717880|ref|YP_008576729.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus saligna] gi|545717966|ref|YP_008576814.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus camaldulensis] gi|545718052|ref|YP_008576899.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus deglupta] gi|545718138|ref|YP_008576984.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus spathulata] gi|545718224|ref|YP_008577069.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus torquata] gi|545718310|ref|YP_008577154.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversicolor] gi|545718396|ref|YP_008577239.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus salmonophloia] gi|545718482|ref|YP_008577324.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus microcorys] gi|545718568|ref|YP_008577409.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus guilfoylei] gi|545718654|ref|YP_008577494.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus erythrocorys] gi|545718740|ref|YP_008577579.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia gummifera] gi|545718826|ref|YP_008577664.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia maculata] gi|545718912|ref|YP_008577749.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia eximia] gi|545718998|ref|YP_008577834.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia tessellaris] gi|545719084|ref|YP_008577919.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora floribunda] gi|545719170|ref|YP_008578004.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora costata] gi|545719256|ref|YP_008578174.1| photosystem I assembly protein Ycf3 (chloroplast) [Stockwellia quadrifida] gi|545719428|ref|YP_008578089.1| photosystem I assembly protein Ycf3 (chloroplast) [Allosyncarpia ternata] gi|122239624|sp|Q49KZ7.1|YCF3_EUCGG RecName: Full=Photosystem I assembly protein ycf3 gi|172045804|sp|Q9MTP0.3|YCF3_OENEH RecName: Full=Photosystem I assembly protein ycf3 gi|60460810|gb|AAX21030.1| ycf3 protein [Eucalyptus globulus subsp. globulus] gi|159792938|gb|ABW98694.1| photosystem I assembly protein Ycf3 [Oenothera argillicola] gi|159793108|gb|ABW98862.1| photosystem I assembly protein Ycf3 [Oenothera biennis] gi|159895462|gb|ABX10027.1| photosystem I assembly protein Ycf3 [Oenothera glazioviana] gi|159895547|gb|ABX10111.1| photosystem I assembly protein Ycf3 [Oenothera parviflora] gi|162423677|emb|CAB67135.2| photosystem I assembly protein Ycf3 [Oenothera elata subsp. hookeri] gi|290488970|gb|ADD30869.1| putative RF3 protein [Euonymus americanus] gi|308223284|gb|ADO23592.1| hypothetical chloroplast RF34 [Eucalyptus grandis] gi|309321267|gb|ADO64810.1| hypothetical chloroplast RF34 [Theobroma cacao] gi|328924784|gb|ADO64891.2| hypothetical chloroplast R34 [Theobroma cacao] gi|371925937|gb|AEX57727.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926019|gb|AEX57808.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926101|gb|AEX57889.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926183|gb|AEX57970.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926265|gb|AEX58051.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926347|gb|AEX58132.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926429|gb|AEX58213.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926511|gb|AEX58294.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926593|gb|AEX58375.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926675|gb|AEX58456.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma grandiflorum] gi|371926757|gb|AEX58537.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|386268366|gb|AFJ00472.1| hypothetical chloroplast RF34 [Francoa sonchifolia] gi|442566154|gb|AGC56353.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus obliqua] gi|442566240|gb|AGC56438.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus radiata] gi|442566326|gb|AGC56523.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus delegatensis] gi|442566412|gb|AGC56608.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus verrucata] gi|442566498|gb|AGC56693.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus baxteri] gi|442566584|gb|AGC56778.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversifolia] gi|442566670|gb|AGC56863.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus sieberi] gi|442566756|gb|AGC56948.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus elata] gi|442566842|gb|AGC57033.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus regnans] gi|442566928|gb|AGC57118.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus umbra] gi|442567014|gb|AGC57203.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cloeziana] gi|442567100|gb|AGC57288.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus patens] gi|442567186|gb|AGC57373.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus marginata] gi|442567272|gb|AGC57458.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus curtisii] gi|442567358|gb|AGC57543.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus melliodora] gi|442567444|gb|AGC57628.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus melliodora] gi|442567530|gb|AGC57713.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus polybractea] gi|442567616|gb|AGC57798.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cladocalyx] gi|442567702|gb|AGC57883.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus globulus] gi|442567788|gb|AGC57968.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus nitens] gi|442567874|gb|AGC58053.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus aromaphloia] gi|442567960|gb|AGC58138.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus saligna] gi|442568046|gb|AGC58223.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus camaldulensis] gi|442568132|gb|AGC58308.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus deglupta] gi|442568218|gb|AGC58393.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus spathulata] gi|442568304|gb|AGC58478.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus torquata] gi|442568390|gb|AGC58563.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversicolor] gi|442568476|gb|AGC58648.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus salmonophloia] gi|442568562|gb|AGC58733.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus microcorys] gi|442568648|gb|AGC58818.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus guilfoylei] gi|442568734|gb|AGC58903.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus erythrocorys] gi|442568820|gb|AGC58988.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia gummifera] gi|442568906|gb|AGC59073.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia maculata] gi|442568992|gb|AGC59158.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia eximia] gi|442569078|gb|AGC59243.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia tessellaris] gi|442569164|gb|AGC59328.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora floribunda] gi|442569250|gb|AGC59413.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora costata] gi|442569336|gb|AGC59498.1| photosystem I assembly protein Ycf3 (chloroplast) [Allosyncarpia ternata] gi|442569422|gb|AGC59583.1| photosystem I assembly protein Ycf3 (chloroplast) [Stockwellia quadrifida] Length = 168 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 168 >gb|AFU96552.1| Ycf3, partial (chloroplast) [Viola pubescens] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96550.1| Ycf3, partial (chloroplast) [Scyphostegia borneensis] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96549.1| Ycf3, partial (chloroplast) [Schistostemon retusum] Length = 126 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 77 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 126 >gb|AFU96544.1| Ycf3, partial (chloroplast) [Ploiarium sp. CCD-2012] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96543.1| Ycf3, partial (chloroplast) [Phyllanthus urinaria] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96536.1| Ycf3, partial (chloroplast) [Linum usitatissimum] Length = 162 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 113 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 162 >gb|AFU96533.1| Ycf3, partial (chloroplast) [Irvingia malayana] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96529.1| Ycf3, partial (chloroplast) [Garcinia mangostana] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96527.1| Ycf3, partial (chloroplast) [Flueggea suffruticosa] gi|408903902|gb|AFU96537.1| Ycf3, partial (chloroplast) [Mammea americana] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96526.1| Ycf3, partial (chloroplast) [Euphorbia maculata] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96524.1| Ycf3, partial (chloroplast) [Elaeodendron orientale] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96520.1| Ycf3, partial (chloroplast) [Caloncoba echinata] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >gb|AFU96517.1| Ycf3, partial (chloroplast) [Bergia texana] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169 >ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] gi|326457040|gb|ADZ74304.1| hypothetical chloroplast RF34 [Gossypium anomalum] gi|335354500|gb|AEH43118.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] Length = 168 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 119 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 168 >ref|YP_005090179.1| ycf3 gene product (chloroplast) [Ricinus communis] gi|339516166|gb|AEJ82556.1| photosystem I assembly protein Ycf3 [Ricinus communis] Length = 169 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 526 RGEQAIRQGDSEIAEAWVRIKPRSIGNKLIALTPGNYIEAQNWLKITRRFE 374 RGEQAIRQGDSEIAEAW + + IALTPGNYIEAQNWLKITRRFE Sbjct: 120 RGEQAIRQGDSEIAEAWFD-QAAEYWKQAIALTPGNYIEAQNWLKITRRFE 169