BLASTX nr result
ID: Jatropha_contig00001719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001719 (466 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521873.1| UBX domain-containing protein, putative [Ric... 57 2e-06 >ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis] gi|223538911|gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis] Length = 452 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 25 SIPGAKTLDYESKLTFGESGLANSMMLVAWE 117 +IPGAK+LDY+SK+TFGESGLANSM+ VAWE Sbjct: 422 AIPGAKSLDYDSKVTFGESGLANSMISVAWE 452 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 5 RPFRLTQA 28 RPFRLTQA Sbjct: 415 RPFRLTQA 422