BLASTX nr result
ID: Jatropha_contig00001680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001680 (197 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002608189.1| ATP synthase F1 subunit 1 [Carica papaya] gi... 78 1e-12 dbj|BAE32582.1| unnamed protein product [Mus musculus] 77 3e-12 emb|CBI38498.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|2099541... 77 3e-12 ref|YP_004237280.1| ATP synthase F1 subunit 1 (mitochondrion) [R... 75 7e-12 ref|XP_002535554.1| ATP synthase, putative [Ricinus communis] gi... 75 7e-12 ref|YP_006666125.1| ATP1 (mitochondrion) [Malus domestica] gi|40... 75 1e-11 ref|XP_006346236.1| PREDICTED: ATP synthase subunit alpha, mitoc... 74 2e-11 gb|AAB03873.1| F1-ATPase alpha subunit [Petunia axillaris subsp.... 74 2e-11 emb|CAA53716.1| truncated putative F1-ATP synthase subunit alpha... 74 2e-11 ref|YP_173459.1| ATP synthase F1 subunit 1 [Nicotiana tabacum] g... 74 2e-11 dbj|BAN09106.1| ATP synthase subunit 1 (mitochondrion) [Solanum ... 73 3e-11 dbj|BAN09100.1| ATP synthase subunit 1 (mitochondrion) [Solanum ... 73 3e-11 gb|AHA47112.1| ATP synthase F1 subunit 1 (mitochondrion) [Ambore... 73 4e-11 ref|YP_003587355.1| ATPase subunit 1 [Cucurbita pepo] gi|2591568... 73 4e-11 ref|YP_007905696.1| ATP synthase F1 subunit 1 (mitochondrion) [L... 72 9e-11 sp|P05492.1|ATPAM_OENBI RecName: Full=ATP synthase subunit alpha... 70 3e-10 ref|YP_005090378.1| ATP synthase F0 subunit 1 (mitochondrion) [P... 70 4e-10 gb|AAB87529.1| F1 ATPase a-subunit [Panax ginseng] 69 6e-10 gb|AAK98045.1|AF301602_1 ATP1 [Daucus carota] gi|15429018|gb|AAK... 69 6e-10 >ref|YP_002608189.1| ATP synthase F1 subunit 1 [Carica papaya] gi|170522368|gb|ACB20478.1| ATP synthase F1 subunit 1 (mitochondrion) [Carica papaya] Length = 509 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSIKPELLQ LLEK GLTNERK+EPDAFLKESA Sbjct: 464 ISQYERAIPSSIKPELLQSLLEKGGLTNERKMEPDAFLKESA 505 >dbj|BAE32582.1| unnamed protein product [Mus musculus] Length = 509 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPS IKPELLQ LLEK GLTNERK+EPDAFLKESA Sbjct: 464 ISQYERAIPSQIKPELLQSLLEKGGLTNERKMEPDAFLKESA 505 >emb|CBI38498.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSIKPE LQ LLEK GLTNERK+EPDAFLKESA Sbjct: 249 ISQYERAIPSSIKPEFLQSLLEKGGLTNERKMEPDAFLKESA 290 >ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|209954192|emb|CAQ77653.1| ATPase subunit 1 [Vitis vinifera] gi|239764719|gb|ACS15190.1| ATPase subunit 1 [Vitis vinifera] Length = 509 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSIKPE LQ LLEK GLTNERK+EPDAFLKESA Sbjct: 464 ISQYERAIPSSIKPEFLQSLLEKGGLTNERKMEPDAFLKESA 505 >ref|YP_004237280.1| ATP synthase F1 subunit 1 (mitochondrion) [Ricinus communis] gi|322394287|gb|ADW96044.1| ATP synthase F1 subunit 1 (mitochondrion) [Ricinus communis] Length = 509 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSIKPELL+ LLEK GLTNERK+EPDAFLKE+A Sbjct: 464 ISQYERAIPSSIKPELLKSLLEKGGLTNERKMEPDAFLKENA 505 >ref|XP_002535554.1| ATP synthase, putative [Ricinus communis] gi|223522668|gb|EEF26828.1| ATP synthase, putative [Ricinus communis] Length = 362 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSIKPELL+ LLEK GLTNERK+EPDAFLKE+A Sbjct: 317 ISQYERAIPSSIKPELLKSLLEKGGLTNERKMEPDAFLKENA 358 >ref|YP_006666125.1| ATP1 (mitochondrion) [Malus domestica] gi|401661928|emb|CBX33384.1| atp1 (mitochondrion) [Malus domestica] Length = 510 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP S+KPELLQ LLEK GLTNERK+EPD FLKESA Sbjct: 464 ISQYERAIPKSVKPELLQSLLEKGGLTNERKMEPDTFLKESA 505 >ref|XP_006346236.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like [Solanum tuberosum] Length = 234 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP+S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 187 ISQYERAIPNSVKPELLQSFLEKGGLTNERKMEPDTFLKESA 228 >gb|AAB03873.1| F1-ATPase alpha subunit [Petunia axillaris subsp. parodii] gi|1421801|gb|AAB03874.1| F1-ATPase alpha subunit [Petunia axillaris subsp. parodii] Length = 509 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP+S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 464 ISQYERAIPNSVKPELLQSFLEKGGLTNERKMEPDTFLKESA 505 >emb|CAA53716.1| truncated putative F1-ATP synthase subunit alpha [Nicotiana tabacum x Nicotiana bigelovii] gi|457793|emb|CAA54916.1| mitochondrial truncated atpA gene [Nicotiana tabacum] gi|1093821|prf||2104428A orf38/220 Length = 258 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP+S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 213 ISQYERAIPNSVKPELLQSFLEKGGLTNERKMEPDTFLKESA 254 >ref|YP_173459.1| ATP synthase F1 subunit 1 [Nicotiana tabacum] gi|114407|sp|P05495.1|ATPAM_NICPL RecName: Full=ATP synthase subunit alpha, mitochondrial gi|13153|emb|CAA30568.1| unnamed protein product [Nicotiana plumbaginifolia] Length = 509 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP+S+KPELLQ LEK GLTNERK+EPD FLKESA Sbjct: 464 ISQYERAIPNSVKPELLQSFLEKGGLTNERKMEPDTFLKESA 505 >dbj|BAN09106.1| ATP synthase subunit 1 (mitochondrion) [Solanum melongena] Length = 511 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP+S+KPELLQ EK GLTNERKIEPD FLKESA Sbjct: 464 ISQYERAIPNSVKPELLQSFFEKGGLTNERKIEPDTFLKESA 505 >dbj|BAN09100.1| ATP synthase subunit 1 (mitochondrion) [Solanum kurzii] gi|472824900|dbj|BAN09103.1| ATP synthase subunit 1 (mitochondrion) [Solanum aethiopicum] Length = 511 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP+S+KPELLQ EK GLTNERKIEPD FLKESA Sbjct: 464 ISQYERAIPNSVKPELLQSFFEKGGLTNERKIEPDTFLKESA 505 >gb|AHA47112.1| ATP synthase F1 subunit 1 (mitochondrion) [Amborella trichopoda] Length = 506 Score = 72.8 bits (177), Expect = 4e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSI PELLQ LLEK GLTNERK+EPDA LKESA Sbjct: 461 ISQYERAIPSSIDPELLQSLLEKGGLTNERKMEPDASLKESA 502 >ref|YP_003587355.1| ATPase subunit 1 [Cucurbita pepo] gi|259156801|gb|ACV96662.1| ATPase subunit 1 [Cucurbita pepo] Length = 509 Score = 72.8 bits (177), Expect = 4e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPS IKPELLQ L K GLTNERK+EPDAFLKESA Sbjct: 464 ISQYERAIPSRIKPELLQSLFSKGGLTNERKMEPDAFLKESA 505 >ref|YP_007905696.1| ATP synthase F1 subunit 1 (mitochondrion) [Liriodendron tulipifera] gi|480541900|gb|AGJ90393.1| ATP synthase F1 subunit 1 (mitochondrion) [Liriodendron tulipifera] Length = 509 Score = 71.6 bits (174), Expect = 9e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESAFR 133 ISQYERAIPSSI P+LLQ LLEK GLTNERK+EPDA LKESA + Sbjct: 464 ISQYERAIPSSIDPKLLQSLLEKGGLTNERKMEPDASLKESALQ 507 >sp|P05492.1|ATPAM_OENBI RecName: Full=ATP synthase subunit alpha, mitochondrial gi|13165|emb|CAA27656.1| unnamed protein product [Oenothera biennis] Length = 511 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIP S+K ELLQ L+EK GL NERKIEPDAFLKE+A Sbjct: 464 ISQYERAIPQSVKQELLQSLVEKGGLNNERKIEPDAFLKENA 505 >ref|YP_005090378.1| ATP synthase F0 subunit 1 (mitochondrion) [Phoenix dactylifera] gi|343478430|gb|AEM43918.1| ATP synthase F0 subunit 1 (mitochondrion) [Phoenix dactylifera] Length = 509 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSI PELL+ LEK GLTNERK+EPDA LKESA Sbjct: 464 ISQYERAIPSSIDPELLKSFLEKGGLTNERKMEPDASLKESA 505 >gb|AAB87529.1| F1 ATPase a-subunit [Panax ginseng] Length = 507 Score = 68.9 bits (167), Expect = 6e-10 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESA 127 ISQYERAIPSSIKPELLQ LLEK GL ERK+EPDAFLKESA Sbjct: 464 ISQYERAIPSSIKPELLQSLLEKGGL--ERKMEPDAFLKESA 503 >gb|AAK98045.1|AF301602_1 ATP1 [Daucus carota] gi|15429018|gb|AAK98046.1|AF301604_1 ATP1 [Daucus carota] Length = 513 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 2 ISQYERAIPSSIKPELLQKLLEKDGLTNERKIEPDAFLKESAFR 133 I Q+E+ I S I PELLQKLLEK GLTNERK+EPDAFLKESAF+ Sbjct: 464 IEQFEKVITSLIIPELLQKLLEKGGLTNERKMEPDAFLKESAFK 507