BLASTX nr result
ID: Jatropha_contig00001573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001573 (479 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM96088.1| hypothetical protein AMTR_s04653p00000520, partia... 58 1e-06 >gb|ERM96088.1| hypothetical protein AMTR_s04653p00000520, partial [Amborella trichopoda] Length = 563 Score = 58.2 bits (139), Expect = 1e-06 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 4/111 (3%) Frame = +3 Query: 30 KKPRGSSLSRVSRPSRNQLSYLIRLPYSRTGAPVI----REVEFTPLSKSRVNILQWMKD 197 K RG S R S P R + S L + P + +P R V +T L+ R +I + + Sbjct: 66 KNARGRSPRRRS-PRRPRSSKLAKSPPKKESSPKRKGGPRFVNYTELAVPRDHI--YAVE 122 Query: 198 KQEEIHFNYPRKLRE*SNEQRDQNKYCAYHKDIGHDTKQCWQLKNEIERLV 350 ++ + F P +R + ++RD K+C YHKDIGH T +CW L++EIE L+ Sbjct: 123 ERNGV-FKKPPPIRG-NRDRRDPKKFCKYHKDIGHTTLECWVLQDEIEELI 171