BLASTX nr result
ID: Jatropha_contig00001302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001302 (256 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526909.1| OTU domain-containing protein 6B, putative [... 55 7e-06 >ref|XP_002526909.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223533728|gb|EEF35462.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 325 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = +2 Query: 2 KEYKXXXXXXXXXXXILLSYHKHAFGLGEHYNSVVPN 112 KEYK ILLSYHKHAFGLGEHYNSVVPN Sbjct: 286 KEYKNDDGAGSSNTSILLSYHKHAFGLGEHYNSVVPN 322