BLASTX nr result
ID: Jatropha_contig00001254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001254 (306 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus... 71 1e-10 gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] 71 1e-10 dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] 71 1e-10 ref|XP_002312342.1| predicted protein [Populus trichocarpa] gi|1... 71 2e-10 ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like ... 70 3e-10 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 70 3e-10 ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 69 5e-10 ref|XP_003546330.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 69 6e-10 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 68 1e-09 ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like ... 68 1e-09 gb|EMJ28728.1| hypothetical protein PRUPE_ppa014537mg [Prunus pe... 67 2e-09 ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like,... 67 2e-09 ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus... 67 2e-09 ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 67 2e-09 gb|AFK42911.1| unknown [Medicago truncatula] 67 3e-09 gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [... 66 4e-09 gb|ESQ42314.1| hypothetical protein EUTSA_v10015219mg [Eutrema s... 66 5e-09 gb|AFK48186.1| unknown [Lotus japonicus] 66 5e-09 gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [... 65 7e-09 ref|XP_004239876.1| PREDICTED: 60S ribosomal protein L29-2-like ... 65 7e-09 >gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|561027712|gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN KSG++ASE+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKSGETASEEE 61 >gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] Length = 61 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN KSG+SA+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] Length = 61 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTST+GMDPKFLRNQRYARKHNNK+G+SA+E+E Sbjct: 27 HRHTSTRGMDPKFLRNQRYARKHNNKTGESATEEE 61 >ref|XP_002312342.1| predicted protein [Populus trichocarpa] gi|118484518|gb|ABK94134.1| unknown [Populus trichocarpa] gi|222852162|gb|EEE89709.1| 60S ribosomal protein L29 [Populus trichocarpa] Length = 61 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K GDSA+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKCGDSATEEE 61 >ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502127331|ref|XP_004499659.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] Length = 61 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHNNK+G+ A+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNNKNGEIATEEE 61 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN KSG++A+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147802163|emb|CAN65958.1| hypothetical protein VITISV_007494 [Vitis vinifera] gi|296083268|emb|CBI22904.3| unnamed protein product [Vitis vinifera] Length = 61 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRH STKGMDPKFLRNQRYARKHN KSG+SA+E+E Sbjct: 27 HRHASTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >ref|XP_003546330.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN KSG+ A+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKSGEIATEEE 61 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K+G+ A+E+E Sbjct: 411 HRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 445 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K+G+ AS ++ Sbjct: 163 HRHTSTKGMDPKFLRNQRYARKHNKKNGEVASAED 197 >ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502150865|ref|XP_004508162.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] gi|388515093|gb|AFK45608.1| unknown [Medicago truncatula] Length = 61 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K+G+ A+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 61 >gb|EMJ28728.1| hypothetical protein PRUPE_ppa014537mg [Prunus persica] gi|462424466|gb|EMJ28729.1| hypothetical protein PRUPE_ppa014537mg [Prunus persica] Length = 61 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHNN +SA+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNNTKNESATEEE 61 >ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like, partial [Cucumis sativus] Length = 85 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYA+KHN KSG++AS +E Sbjct: 51 HRHTSTKGMDPKFLRNQRYAKKHNTKSGENASGEE 85 >ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus communis] gi|223541515|gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 6 RHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 RHTSTKGMDPKFLRNQRYARKHN KSG++A+E+E Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN KS SA+E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKSEGSATEEE 61 >gb|AFK42911.1| unknown [Medicago truncatula] Length = 61 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K+G+ AS +E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKNGEVASAEE 61 >gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQ 104 HRHTSTKGMDPKFLRNQRYARKHN + G+SA+E+ Sbjct: 55 HRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 88 >gb|ESQ42314.1| hypothetical protein EUTSA_v10015219mg [Eutrema salsugineum] Length = 59 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASE 101 HRHTSTKGMDPKFLRNQRYARKHN KSG++A E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNVKSGENAEE 59 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K +S +E+E Sbjct: 27 HRHTSTKGMDPKFLRNQRYARKHNKKGAESVTEEE 61 >gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] Length = 108 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 107 HRHTSTKGMDPKFLRNQRYARKHN K ++A+E+E Sbjct: 74 HRHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 108 >ref|XP_004239876.1| PREDICTED: 60S ribosomal protein L29-2-like [Solanum lycopersicum] Length = 60 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 3 HRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQ 104 HRH+STKGMDPKFLRNQRYARKHN K+G++A+E+ Sbjct: 27 HRHSSTKGMDPKFLRNQRYARKHNKKNGETAAEE 60