BLASTX nr result
ID: Jatropha_contig00001154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00001154 (333 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus... 83 3e-14 gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] 83 3e-14 ref|XP_002312342.1| predicted protein [Populus trichocarpa] gi|1... 83 4e-14 ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like ... 82 7e-14 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 82 7e-14 dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] 81 2e-13 ref|XP_003546330.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 81 2e-13 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 80 3e-13 ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like ... 80 3e-13 ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus... 79 6e-13 ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 79 6e-13 gb|AFK42911.1| unknown [Medicago truncatula] 79 8e-13 gb|EMJ28728.1| hypothetical protein PRUPE_ppa014537mg [Prunus pe... 78 1e-12 gb|AFK48186.1| unknown [Lotus japonicus] 78 1e-12 gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [... 77 2e-12 ref|XP_002314927.1| predicted protein [Populus trichocarpa] gi|1... 77 2e-12 gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [... 77 2e-12 ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like,... 77 2e-12 gb|ESQ42314.1| hypothetical protein EUTSA_v10015219mg [Eutrema s... 77 3e-12 ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 77 3e-12 >gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|561027712|gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN KSG++ASE+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETASEEE 61 >gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] Length = 61 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN KSG+SA+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >ref|XP_002312342.1| predicted protein [Populus trichocarpa] gi|118484518|gb|ABK94134.1| unknown [Populus trichocarpa] gi|222852162|gb|EEE89709.1| 60S ribosomal protein L29 [Populus trichocarpa] Length = 61 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K GDSA+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCGDSATEEE 61 >ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502127331|ref|XP_004499659.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] Length = 61 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNK+G+ A+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKNGEIATEEE 61 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN KSG++A+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] Length = 61 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKP++HRHTST+GMDPKFLRNQRYARKHNNK+G+SA+E+E Sbjct: 21 IKKPRKHRHTSTRGMDPKFLRNQRYARKHNNKTGESATEEE 61 >ref|XP_003546330.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN KSG+ A+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGEIATEEE 61 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 79.7 bits (195), Expect = 3e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K+G+ A+E+E Sbjct: 405 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 445 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K+G+ AS ++ Sbjct: 157 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEVASAED 197 >ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502150865|ref|XP_004508162.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] gi|388515093|gb|AFK45608.1| unknown [Medicago truncatula] Length = 61 Score = 79.7 bits (195), Expect = 3e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K+G+ A+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 61 >ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus communis] gi|223541515|gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKR RHTSTKGMDPKFLRNQRYARKHN KSG++A+E+E Sbjct: 21 IKKPKRQRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147802163|emb|CAN65958.1| hypothetical protein VITISV_007494 [Vitis vinifera] gi|296083268|emb|CBI22904.3| unnamed protein product [Vitis vinifera] Length = 61 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKP++HRH STKGMDPKFLRNQRYARKHN KSG+SA+E+E Sbjct: 21 IKKPRKHRHASTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >gb|AFK42911.1| unknown [Medicago truncatula] Length = 61 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K+G+ AS +E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEVASAEE 61 >gb|EMJ28728.1| hypothetical protein PRUPE_ppa014537mg [Prunus persica] gi|462424466|gb|EMJ28729.1| hypothetical protein PRUPE_ppa014537mg [Prunus persica] Length = 61 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKP+RHRHTSTKGMDPKFLRNQRYARKHNN +SA+E+E Sbjct: 21 IKKPQRHRHTSTKGMDPKFLRNQRYARKHNNTKNESATEEE 61 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K +S +E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKGAESVTEEE 61 >gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] Length = 108 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K ++A+E+E Sbjct: 68 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 108 >ref|XP_002314927.1| predicted protein [Populus trichocarpa] gi|118481247|gb|ABK92573.1| unknown [Populus trichocarpa] gi|118482323|gb|ABK93087.1| unknown [Populus trichocarpa] gi|118483414|gb|ABK93607.1| unknown [Populus trichocarpa] Length = 61 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKPKRHRHTSTKGMDPKFLRNQRYARKHN K ++A+E+E Sbjct: 21 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 61 >gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQ 123 IKKPK+HRHTSTKGMDPKFLRNQRYARKHN + G+SA+E+ Sbjct: 49 IKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 88 >ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like, partial [Cucumis sativus] Length = 85 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKP++HRHTSTKGMDPKFLRNQRYA+KHN KSG++AS +E Sbjct: 45 IKKPRKHRHTSTKGMDPKFLRNQRYAKKHNTKSGENASGEE 85 >gb|ESQ42314.1| hypothetical protein EUTSA_v10015219mg [Eutrema salsugineum] Length = 59 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASE 120 IKKP+RHRHTSTKGMDPKFLRNQRYARKHN KSG++A E Sbjct: 21 IKKPRRHRHTSTKGMDPKFLRNQRYARKHNVKSGENAEE 59 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 4 IKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 126 IKKP++HRHTSTKGMDPKFLRNQRYARKHN KS SA+E+E Sbjct: 21 IKKPRKHRHTSTKGMDPKFLRNQRYARKHNKKSEGSATEEE 61