BLASTX nr result
ID: Jatropha_contig00000986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000986 (323 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19... 83 3e-14 ref|XP_002300049.1| predicted protein [Populus trichocarpa] 71 1e-10 gb|EEE84854.2| hypothetical protein POPTR_0001s35270g, partial [... 70 3e-10 gb|ADB03185.1| oleosin II [Vernicia fordii] 70 4e-10 ref|XP_002323804.1| predicted protein [Populus trichocarpa] gi|2... 68 1e-09 ref|XP_002521458.1| Oleosin1 [Ricinus communis] gi|38259656|gb|A... 67 2e-09 gb|ABQ57396.1| oleosin H-isoform [Ficus pumila var. awkeotsang] 60 3e-07 gb|AAO67349.2| oleosin [Corylus avellana] 59 5e-07 ref|XP_004142849.1| PREDICTED: oleosin 18.2 kDa-like [Cucumis sa... 59 6e-07 ref|XP_004141106.1| PREDICTED: oleosin 5-like [Cucumis sativus] ... 58 1e-06 ref|XP_004304649.1| PREDICTED: oleosin 18.2 kDa-like [Fragaria v... 56 4e-06 gb|AAM46777.1|AF466102_1 16.9 kDa oleosin [Theobroma cacao] gi|5... 56 4e-06 gb|ABB01624.1| oleosin high molecular weight isoform [Linum usit... 56 5e-06 gb|ACG69508.1| oleosin S4-2 [Brassica napus] 55 9e-06 >gb|ABW90149.2| oleosin 2 [Jatropha curcas] gi|399105971|gb|AFP19884.1| 16.6 kDa oleosin [Jatropha curcas] Length = 155 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 306 RRMPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 RRMPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK Sbjct: 116 RRMPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 155 >ref|XP_002300049.1| predicted protein [Populus trichocarpa] Length = 149 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 MPE LD AK+RMQDMAG+VGQKTKEVGQEIQRKAH+GK Sbjct: 112 MPESLDQAKRRMQDMAGYVGQKTKEVGQEIQRKAHDGK 149 >gb|EEE84854.2| hypothetical protein POPTR_0001s35270g, partial [Populus trichocarpa] Length = 214 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 MP+ LD AK+RMQDMAG+VGQKTKEVGQEIQRKAH+GK Sbjct: 177 MPDSLDQAKRRMQDMAGYVGQKTKEVGQEIQRKAHDGK 214 >gb|ADB03185.1| oleosin II [Vernicia fordii] Length = 154 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -3 Query: 306 RRMPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 R +PEQLD A++RMQDMAG+VGQKTKE+GQEIQ+K HEGK Sbjct: 115 RNIPEQLDQARRRMQDMAGYVGQKTKEMGQEIQKKTHEGK 154 >ref|XP_002323804.1| predicted protein [Populus trichocarpa] gi|222866806|gb|EEF03937.1| oleosin family protein [Populus trichocarpa] Length = 149 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 306 RRMPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 R MPE LD AK+ MQDMAG+VGQ+ KEVGQEIQRKAHEGK Sbjct: 110 RTMPENLDQAKRCMQDMAGYVGQRAKEVGQEIQRKAHEGK 149 >ref|XP_002521458.1| Oleosin1 [Ricinus communis] gi|38259656|gb|AAR15171.1| oleosin [Ricinus communis] gi|223539357|gb|EEF40948.1| Oleosin1 [Ricinus communis] Length = 153 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 MPE LD AKKRMQDMAG+VG KTKEVGQ+IQRKA EGK Sbjct: 116 MPESLDQAKKRMQDMAGYVGMKTKEVGQDIQRKAQEGK 153 >gb|ABQ57396.1| oleosin H-isoform [Ficus pumila var. awkeotsang] Length = 155 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 +P+QLD AK+R+QDMAG+ GQK KEVGQE+Q K EGK Sbjct: 116 VPDQLDYAKRRVQDMAGYTGQKAKEVGQEVQSKGQEGK 153 >gb|AAO67349.2| oleosin [Corylus avellana] Length = 159 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 +P ++D AK+RMQDMA FVGQKT+EVGQEIQ +A EG+ Sbjct: 120 LPREMDQAKRRMQDMAAFVGQKTREVGQEIQSRAQEGR 157 >ref|XP_004142849.1| PREDICTED: oleosin 18.2 kDa-like [Cucumis sativus] gi|449483909|ref|XP_004156729.1| PREDICTED: oleosin 18.2 kDa-like [Cucumis sativus] Length = 165 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHE 193 +PEQ+D+AK++MQDMAG+VGQKTKEVGQEIQ + + Sbjct: 118 VPEQMDMAKRKMQDMAGYVGQKTKEVGQEIQSRTQD 153 >ref|XP_004141106.1| PREDICTED: oleosin 5-like [Cucumis sativus] gi|449524042|ref|XP_004169032.1| PREDICTED: oleosin 5-like [Cucumis sativus] Length = 158 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHE 193 MP+Q+D AK+RMQDMAG+VGQKTK++GQEIQ + E Sbjct: 118 MPDQIDQAKRRMQDMAGYVGQKTKDLGQEIQSRTQE 153 >ref|XP_004304649.1| PREDICTED: oleosin 18.2 kDa-like [Fragaria vesca subsp. vesca] Length = 169 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 +PEQLD AK+RM DM ++GQKTKEVGQ+IQ+KA E K Sbjct: 124 VPEQLDSAKRRMADMGEYLGQKTKEVGQDIQQKAQETK 161 >gb|AAM46777.1|AF466102_1 16.9 kDa oleosin [Theobroma cacao] gi|508710590|gb|EOY02487.1| Oleosin family protein, putative [Theobroma cacao] Length = 160 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/37 (75%), Positives = 34/37 (91%), Gaps = 2/37 (5%) Frame = -3 Query: 294 EQLDI--AKKRMQDMAGFVGQKTKEVGQEIQRKAHEG 190 EQLD+ AK+RMQDMAG+VGQKTKEVGQ+I+ KA+EG Sbjct: 120 EQLDMDQAKRRMQDMAGYVGQKTKEVGQKIEGKANEG 156 >gb|ABB01624.1| oleosin high molecular weight isoform [Linum usitatissimum] Length = 180 Score = 55.8 bits (133), Expect = 5e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 +P+ D AK+RMQD AG++GQKTKEVGQEIQRK+ + K Sbjct: 139 VPDSFDQAKRRMQDAAGYMGQKTKEVGQEIQRKSQDVK 176 >gb|ACG69508.1| oleosin S4-2 [Brassica napus] Length = 212 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -3 Query: 300 MPEQLDIAKKRMQDMAGFVGQKTKEVGQEIQRKAHEGK 187 +PEQL+ AKKRM D G+ GQK KE+GQ +Q KAHE K Sbjct: 150 VPEQLEYAKKRMADAVGYAGQKGKEMGQHVQNKAHEAK 187