BLASTX nr result
ID: Jatropha_contig00000968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000968 (185 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE93847.2| hypothetical protein POPTR_0005s24580g [Populus t... 60 3e-07 ref|XP_002306851.1| predicted protein [Populus trichocarpa] 60 3e-07 >gb|EEE93847.2| hypothetical protein POPTR_0005s24580g [Populus trichocarpa] Length = 461 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +2 Query: 2 AGNTSVMRAMPLDVLMNSYRMSPSEAHPVKRNRHPQSMLFTPT 130 AG+ SVMRAMP+DV+ N+Y++SP EA +K NR PQSML +PT Sbjct: 415 AGSISVMRAMPIDVISNAYQISPREAEQLKMNRDPQSMLLSPT 457 >ref|XP_002306851.1| predicted protein [Populus trichocarpa] Length = 461 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +2 Query: 2 AGNTSVMRAMPLDVLMNSYRMSPSEAHPVKRNRHPQSMLFTPT 130 AG+ SVMRAMP+DV+ N+Y++SP EA +K NR PQSML +PT Sbjct: 415 AGSISVMRAMPIDVISNAYQISPREAEQLKMNRDPQSMLLSPT 457