BLASTX nr result
ID: Jatropha_contig00000845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000845 (123 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK71804.1| ribosomal protein L2 [Caryocar glabrum] 82 5e-14 gb|AAT69103.1| ribosomal protein L2 [Schizanthus pinnatus] 82 7e-14 emb|CDI73605.1| ribosomal protein L2 [Pyrus spinosa] 82 9e-14 gb|AGK82954.1| ribosomal protein L2 (chloroplast) [Lupinus luteu... 82 9e-14 emb|CDJ38673.1| ribosomal protein L2 (chloroplast) [Schwalbea am... 82 9e-14 gb|AHA84930.1| ribosomal protein L2 [Ajuga reptans] gi|558697203... 82 9e-14 ref|YP_008814985.1| ribosomal protein L2 (chloroplast) [Brassaio... 82 9e-14 ref|YP_008816000.1| ribosomal protein L2 (chloroplast) [Lindenbe... 82 9e-14 gb|AGW04938.1| ribosomal protein L2 [Telosma cordata] 82 9e-14 gb|AGW04557.1| ribosomal protein L2 [Eustegia minuta] 82 9e-14 gb|AGW04481.1| ribosomal protein L2 [Astephanus triflorus] 82 9e-14 gb|EPS74502.1| hypothetical protein M569_00219 [Genlisea aurea] 82 9e-14 gb|AGQ50384.1| ribosomal protein L2 (chloroplast) [Rumex acetosa] 82 9e-14 gb|AGQ50373.1| ribosomal protein L2 (chloroplast) [Rumex acetosa] 82 9e-14 ref|YP_008081307.1| ribosomal protein L2 (chloroplast) [Catharan... 82 9e-14 ref|YP_008082774.1| ribosomal protein L2 [Prinsepia utilis] gi|5... 82 9e-14 ref|YP_008082622.1| ribosomal protein L2 (chloroplast) [Utricula... 82 9e-14 ref|YP_008081520.1| ribosomal protein L2 (chloroplast) [Trochode... 82 9e-14 ref|YP_008081429.1| ribosomal protein L2 (chloroplast) [Tetracen... 82 9e-14 ref|YP_008081407.1| ribosomal protein L2 (chloroplast) [Tetracen... 82 9e-14 >gb|AEK71804.1| ribosomal protein L2 [Caryocar glabrum] Length = 277 Score = 82.4 bits (202), Expect = 5e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 4 KSIFXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 K F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 KIYFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 104 >gb|AAT69103.1| ribosomal protein L2 [Schizanthus pinnatus] Length = 201 Score = 82.0 bits (201), Expect = 7e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 4 KSIFXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 K F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 21 KMDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 60 >emb|CDI73605.1| ribosomal protein L2 [Pyrus spinosa] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|AGK82954.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] gi|485474374|gb|AGK82976.1| ribosomal protein L2 (chloroplast) [Lupinus luteus] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >emb|CDJ38673.1| ribosomal protein L2 (chloroplast) [Schwalbea americana] gi|560176761|emb|CDJ38702.1| ribosomal protein L2 (chloroplast) [Schwalbea americana] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|AHA84930.1| ribosomal protein L2 [Ajuga reptans] gi|558697203|gb|AHA84958.1| ribosomal protein L2 [Ajuga reptans] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >ref|YP_008814985.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|558602978|ref|YP_008815008.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|558603041|ref|YP_008815072.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|558603066|ref|YP_008815095.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|558603129|ref|YP_008815159.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|558603154|ref|YP_008815182.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|563940320|ref|YP_008814898.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|563940345|ref|YP_008814921.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|563940426|ref|YP_008815246.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|563940451|ref|YP_008815269.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|458599131|gb|AGG38997.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|458599156|gb|AGG39022.1| ribosomal protein L2 (chloroplast) [Aralia undulata] gi|458599233|gb|AGG39084.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|458599258|gb|AGG39109.1| ribosomal protein L2 (chloroplast) [Brassaiopsis hainla] gi|458599412|gb|AGG39171.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|458599437|gb|AGG39196.1| ribosomal protein L2 (chloroplast) [Metapanax delavayi] gi|458599565|gb|AGG39258.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|458599590|gb|AGG39283.1| ribosomal protein L2 (chloroplast) [Schefflera delavayi] gi|458599653|gb|AGG39345.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] gi|458599678|gb|AGG39370.1| ribosomal protein L2 (chloroplast) [Kalopanax septemlobus] Length = 275 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >ref|YP_008816000.1| ribosomal protein L2 (chloroplast) [Lindenbergia philippensis] gi|557136927|emb|CDI43981.1| ribosomal protein L2 (chloroplast) [Lindenbergia philippensis] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|AGW04938.1| ribosomal protein L2 [Telosma cordata] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|AGW04557.1| ribosomal protein L2 [Eustegia minuta] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|AGW04481.1| ribosomal protein L2 [Astephanus triflorus] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|EPS74502.1| hypothetical protein M569_00219 [Genlisea aurea] Length = 286 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 62 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 98 >gb|AGQ50384.1| ribosomal protein L2 (chloroplast) [Rumex acetosa] Length = 275 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >gb|AGQ50373.1| ribosomal protein L2 (chloroplast) [Rumex acetosa] Length = 308 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >ref|YP_008081307.1| ribosomal protein L2 (chloroplast) [Catharanthus roseus] gi|511348401|ref|YP_008081330.1| ribosomal protein L2 (chloroplast) [Catharanthus roseus] gi|474452118|gb|AGI51186.1| ribosomal protein L2 (chloroplast) [Catharanthus roseus] gi|474452141|gb|AGI51209.1| ribosomal protein L2 (chloroplast) [Catharanthus roseus] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >ref|YP_008082774.1| ribosomal protein L2 [Prinsepia utilis] gi|511943736|ref|YP_008082795.1| ribosomal protein L2 [Prinsepia utilis] gi|501418863|gb|AGL94740.1| ribosomal protein L2 [Prinsepia utilis] gi|501418885|gb|AGL94762.1| ribosomal protein L2 [Prinsepia utilis] Length = 271 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 61 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 97 >ref|YP_008082622.1| ribosomal protein L2 (chloroplast) [Utricularia gibba] gi|498921895|gb|AGL61116.1| ribosomal protein L2 (chloroplast) [Utricularia gibba] Length = 275 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101 >ref|YP_008081520.1| ribosomal protein L2 (chloroplast) [Trochodendron aralioides] gi|479279359|gb|AGJ72212.1| ribosomal protein L2 (chloroplast) [Trochodendron aralioides] Length = 272 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 63 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 99 >ref|YP_008081429.1| ribosomal protein L2 (chloroplast) [Tetracentron sinense] gi|479279266|gb|AGJ72120.1| ribosomal protein L2 (chloroplast) [Tetracentron sinense] Length = 272 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 63 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 99 >ref|YP_008081407.1| ribosomal protein L2 (chloroplast) [Tetracentron sinense] gi|479279245|gb|AGJ72099.1| ribosomal protein L2 (chloroplast) [Tetracentron sinense] Length = 274 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 13 FXRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 123 F RNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY Sbjct: 65 FRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRY 101