BLASTX nr result
ID: Jatropha_contig00000800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000800 (320 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS96444.1| major allergen Pru ar 1-like protein [Jatropha cu... 64 2e-08 >gb|ACS96444.1| major allergen Pru ar 1-like protein [Jatropha curcas] Length = 164 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +2 Query: 2 VCKRSCKAYTVDGVEVKEDEIRGSLEKTMQVFFGSFKLYEAYALANPDA 148 +C+RS K+YTVDG+EV E+EI+ M++F G FK +EAYALAN DA Sbjct: 116 ICRRSSKSYTVDGIEVNEEEIKAGQATAMELFAGIFKTFEAYALANSDA 164