BLASTX nr result
ID: Jatropha_contig00000653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000653 (565 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA30522.1| ORF 143 [Glycine max] 150 5e-37 gb|AFK49064.1| unknown [Lotus japonicus] 145 1e-34 ref|NP_001238194.1| uncharacterized protein LOC100306140 [Glycin... 99 1e-22 gb|AFU96936.1| Rps7, partial (chloroplast) [Trigonia sp. CCD-2012] 94 6e-21 gb|AFU96930.1| Rps7, partial (chloroplast) [Podocalyx loranthoides] 94 6e-21 gb|AFU96926.1| Rps7, partial (chloroplast) [Passiflora ciliata] 94 6e-21 gb|AFU96919.1| Rps7, partial (chloroplast) [Ixonanthes sp. CCD-2... 94 6e-21 gb|AFU96914.1| Rps7, partial (chloroplast) [Goupia glabra] 94 6e-21 gb|AFU96913.1| Rps7, partial (chloroplast) [Garcinia mangostana] 94 6e-21 gb|AFU96911.1| Rps7, partial (chloroplast) [Flueggea suffruticosa] 94 6e-21 gb|AFU96899.1| Rps7, partial (chloroplast) [Bergia texana] gi|40... 94 6e-21 gb|AHA84951.1| ribosomal protein S7 [Ajuga reptans] 94 6e-21 gb|EPS74509.1| hypothetical protein M569_00226 [Genlisea aurea] 94 6e-21 sp|Q6KGY2.1|RR7_GUNCH RecName: Full=30S ribosomal protein S7, ch... 94 6e-21 ref|YP_636344.1| ribosomal protein S7 [Eucalyptus globulus subsp... 94 6e-21 gb|AFG25696.1| ribosomal protein S7, partial [Iris virginica] 94 6e-21 ref|YP_005296145.1| rps7 gene product (chloroplast) [Pentactina ... 94 6e-21 gb|AEK71881.1| ribosomal protein S7 [Myrothamnus flabellifolia] 94 6e-21 gb|AEK71593.1| ribosomal protein S7 [Terminalia catappa] 94 6e-21 ref|YP_004327720.1| ribosomal protein S7 [Hevea brasiliensis] gi... 94 6e-21 >emb|CAA30522.1| ORF 143 [Glycine max] Length = 143 Score = 150 bits (379), Expect(2) = 5e-37 Identities = 73/83 (87%), Positives = 75/83 (90%) Frame = -2 Query: 495 LHYLRNPRTQSYGYVKYRIFNPSRKRKERDTQFKVSKQNSILDLIDTYRILWKAVFDESR 316 LHY NPRTQSYGYVKYRI NPSRKR DTQF+VSKQNSILD+IDTYRILWKAVFDESR Sbjct: 60 LHYFGNPRTQSYGYVKYRISNPSRKRGGTDTQFQVSKQNSILDIIDTYRILWKAVFDESR 119 Query: 315 MYGLEGGLSYLSRSTLQYGVKKP 247 MYGLEG LSYLSRSTLQYG KKP Sbjct: 120 MYGLEGDLSYLSRSTLQYGAKKP 142 Score = 30.0 bits (66), Expect(2) = 5e-37 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 548 EFFRTVPSQIAMIRSTSFY 492 +FFR PSQIAMIRST Y Sbjct: 44 DFFRIGPSQIAMIRSTLHY 62 >gb|AFK49064.1| unknown [Lotus japonicus] Length = 128 Score = 145 bits (367), Expect(2) = 1e-34 Identities = 72/83 (86%), Positives = 75/83 (90%) Frame = -2 Query: 495 LHYLRNPRTQSYGYVKYRIFNPSRKRKERDTQFKVSKQNSILDLIDTYRILWKAVFDESR 316 LHY N RTQSYGYVKYRI NPS+KR+E DTQF+VSKQNSILDLIDTYRIL KAVFDESR Sbjct: 45 LHYFENLRTQSYGYVKYRISNPSKKRRETDTQFQVSKQNSILDLIDTYRILRKAVFDESR 104 Query: 315 MYGLEGGLSYLSRSTLQYGVKKP 247 MYGLEG LSYLSRSTLQYG KKP Sbjct: 105 MYGLEGDLSYLSRSTLQYGAKKP 127 Score = 26.9 bits (58), Expect(2) = 1e-34 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 542 FRTVPSQIAMIRSTSFY 492 FR PSQIAMIRST Y Sbjct: 31 FRLGPSQIAMIRSTLHY 47 >ref|NP_001238194.1| uncharacterized protein LOC100306140 [Glycine max] gi|255627661|gb|ACU14175.1| unknown [Glycine max] Length = 173 Score = 99.0 bits (245), Expect(2) = 1e-22 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -3 Query: 194 PCTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 P TLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 15 PFTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 71 Score = 33.1 bits (74), Expect(2) = 1e-22 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 64 AMKKIQQKTETNPLS 78 >gb|AFU96936.1| Rps7, partial (chloroplast) [Trigonia sp. CCD-2012] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96930.1| Rps7, partial (chloroplast) [Podocalyx loranthoides] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96926.1| Rps7, partial (chloroplast) [Passiflora ciliata] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96919.1| Rps7, partial (chloroplast) [Ixonanthes sp. CCD-2012] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96914.1| Rps7, partial (chloroplast) [Goupia glabra] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96913.1| Rps7, partial (chloroplast) [Garcinia mangostana] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96911.1| Rps7, partial (chloroplast) [Flueggea suffruticosa] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFU96899.1| Rps7, partial (chloroplast) [Bergia texana] gi|408904714|gb|AFU96905.1| Rps7, partial (chloroplast) [Clusia rosea] gi|408904724|gb|AFU96910.1| Rps7, partial (chloroplast) [Euphorbia maculata] gi|408904734|gb|AFU96915.1| Rps7, partial (chloroplast) [Humiria balsamifera] gi|408904740|gb|AFU96918.1| Rps7, partial (chloroplast) [Irvingia malayana] gi|408904748|gb|AFU96922.1| Rps7, partial (chloroplast) [Mammea americana] gi|408904750|gb|AFU96923.1| Rps7, partial (chloroplast) [Medusagyne oppositifolia] gi|408904754|gb|AFU96925.1| Rps7, partial (chloroplast) [Ouratea sp. CCD-2012] gi|408904758|gb|AFU96927.1| Rps7, partial (chloroplast) [Pera bumeliifolia] gi|408904760|gb|AFU96928.1| Rps7, partial (chloroplast) [Phyllanthus urinaria] gi|408904762|gb|AFU96929.1| Rps7, partial (chloroplast) [Ploiarium sp. CCD-2012] gi|408904768|gb|AFU96932.1| Rps7, partial (chloroplast) [Quiina glaziovii] gi|408904772|gb|AFU96934.1| Rps7, partial (chloroplast) [Schistostemon retusum] Length = 162 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AHA84951.1| ribosomal protein S7 [Ajuga reptans] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|EPS74509.1| hypothetical protein M569_00226 [Genlisea aurea] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >sp|Q6KGY2.1|RR7_GUNCH RecName: Full=30S ribosomal protein S7, chloroplastic gi|33338894|gb|AAQ14209.1| ribosomal protein S7 [Gunnera chilensis] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >ref|YP_636344.1| ribosomal protein S7 [Eucalyptus globulus subsp. globulus] gi|108802703|ref|YP_636359.1| ribosomal protein S7 [Eucalyptus globulus subsp. globulus] gi|169794118|ref|YP_001718482.1| ribosomal protein S7 [Manihot esculenta] gi|169794132|ref|YP_001718495.1| ribosomal protein S7 [Manihot esculenta] gi|225544181|ref|YP_002720171.1| rps7 [Jatropha curcas] gi|225544188|ref|YP_002720158.1| rps7 [Jatropha curcas] gi|309322490|ref|YP_003934004.1| ribosomal protein S7 [Eucalyptus grandis] gi|309322502|ref|YP_003934015.1| ribosomal protein S7 [Eucalyptus grandis] gi|456061496|ref|YP_007475665.1| ribosomal protein S7 [Heliconia collinsiana] gi|456061511|ref|YP_007475678.1| ribosomal protein S7 [Heliconia collinsiana] gi|501770899|ref|YP_007889906.1| ribosomal protein S7 [Francoa sonchifolia] gi|501770912|ref|YP_007889918.1| ribosomal protein S7 [Francoa sonchifolia] gi|545716290|ref|YP_008575158.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gi|545716305|ref|YP_008575173.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gi|545716376|ref|YP_008575243.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gi|545716391|ref|YP_008575258.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gi|545716462|ref|YP_008575328.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gi|545716477|ref|YP_008575343.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gi|545716548|ref|YP_008575413.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gi|545716563|ref|YP_008575428.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gi|545716634|ref|YP_008575498.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gi|545716649|ref|YP_008575513.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gi|545716720|ref|YP_008575583.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gi|545716735|ref|YP_008575598.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gi|545716806|ref|YP_008575668.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gi|545716821|ref|YP_008575683.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gi|545716892|ref|YP_008575753.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gi|545716907|ref|YP_008575768.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gi|545716978|ref|YP_008575838.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gi|545716993|ref|YP_008575853.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gi|545717064|ref|YP_008575923.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gi|545717079|ref|YP_008575938.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gi|545717150|ref|YP_008576008.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gi|545717165|ref|YP_008576023.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gi|545717236|ref|YP_008576093.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gi|545717251|ref|YP_008576108.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gi|545717322|ref|YP_008576178.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gi|545717337|ref|YP_008576193.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gi|545717408|ref|YP_008576263.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gi|545717423|ref|YP_008576278.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gi|545717494|ref|YP_008576348.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gi|545717509|ref|YP_008576363.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gi|545717580|ref|YP_008576433.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gi|545717595|ref|YP_008576448.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gi|545717666|ref|YP_008576518.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gi|545717681|ref|YP_008576533.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gi|545717752|ref|YP_008576603.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gi|545717767|ref|YP_008576618.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gi|545717838|ref|YP_008576688.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gi|545717853|ref|YP_008576703.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gi|545717924|ref|YP_008576773.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gi|545717939|ref|YP_008576788.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gi|545718010|ref|YP_008576858.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gi|545718025|ref|YP_008576873.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gi|545718096|ref|YP_008576943.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gi|545718111|ref|YP_008576958.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gi|545718182|ref|YP_008577028.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gi|545718197|ref|YP_008577043.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gi|545718268|ref|YP_008577113.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gi|545718283|ref|YP_008577128.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gi|545718354|ref|YP_008577198.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gi|545718369|ref|YP_008577213.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gi|545718440|ref|YP_008577283.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gi|545718455|ref|YP_008577298.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gi|545718526|ref|YP_008577368.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gi|545718541|ref|YP_008577383.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gi|545718612|ref|YP_008577453.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gi|545718627|ref|YP_008577468.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gi|545718698|ref|YP_008577538.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gi|545718713|ref|YP_008577553.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gi|545718784|ref|YP_008577623.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gi|545718799|ref|YP_008577638.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gi|545718956|ref|YP_008577793.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gi|545718971|ref|YP_008577808.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gi|545719042|ref|YP_008577878.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gi|545719057|ref|YP_008577893.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gi|545719128|ref|YP_008577963.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gi|545719143|ref|YP_008577978.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gi|545719214|ref|YP_008578048.1| ribosomal protein S7 (chloroplast) [Angophora costata] gi|545719229|ref|YP_008578063.1| ribosomal protein S7 (chloroplast) [Angophora costata] gi|545719300|ref|YP_008578218.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gi|545719315|ref|YP_008578233.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gi|545719472|ref|YP_008578133.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gi|545719487|ref|YP_008578148.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gi|563940598|ref|YP_008854471.1| ribosomal protein S7 [Musa textilis] gi|563940612|ref|YP_008854484.1| ribosomal protein S7 [Musa textilis] gi|122249136|sp|Q49KT8.1|RR7_EUCGG RecName: Full=30S ribosomal protein S7, chloroplastic gi|205831453|sp|B1NWJ5.1|RR7_MANES RecName: Full=30S ribosomal protein S7, chloroplastic gi|37721219|gb|AAN31997.1| ribosomal protein S7 [Hydrothrix gardneri] gi|37721249|gb|AAN32019.1| ribosomal protein S7 [Xiphidium caeruleum] gi|60460852|gb|AAX21072.1| ribosomal protein S7 [Eucalyptus globulus subsp. globulus] gi|60460869|gb|AAX21089.1| ribosomal protein S7 [Eucalyptus globulus subsp. globulus] gi|146261260|gb|ABQ14878.1| ribosomal protein S7 [Myriophyllum spicatum] gi|146261278|gb|ABQ14894.1| ribosomal protein S7 [Penthorum chinense] gi|149275490|gb|ABR23076.1| ribosomal protein S7 [Anigozanthos flavidus] gi|149275502|gb|ABR23084.1| ribosomal protein S7 [Eichhornia crassipes] gi|156598313|gb|ABU85417.1| ribosomal protein S7 [Musa acuminata] gi|157695930|gb|ABV66199.1| ribosomal protein S7 [Manihot esculenta] gi|157695944|gb|ABV66213.1| ribosomal protein S7 [Manihot esculenta] gi|224979622|gb|ACN72749.1| rps7 [Jatropha curcas] gi|224979629|gb|ACN72756.1| rps7 [Jatropha curcas] gi|290487044|gb|ADD29906.1| ribosomal protein S7 [Gunnera manicata] gi|290487050|gb|ADD29909.1| ribosomal protein S7 [Oxalis latifolia] gi|296936717|gb|ADH94389.1| ribosomal protein S7 [Syzygium cumini] gi|296936730|gb|ADH94402.1| ribosomal protein S7 [Syzygium cumini] gi|308223324|gb|ADO23632.1| ribosomal protein S7 [Eucalyptus grandis] gi|308223336|gb|ADO23644.1| ribosomal protein S7 [Eucalyptus grandis] gi|340806908|gb|AEK71541.1| ribosomal protein S7 [Phyllanthus calycinus] gi|340806929|gb|AEK71559.1| ribosomal protein S7 [Quillaja saponaria] gi|340807134|gb|AEK71732.1| ribosomal protein S7 [Oxalis latifolia] gi|340807150|gb|AEK71746.1| ribosomal protein S7 [Gunnera manicata] gi|340807213|gb|AEK71801.1| ribosomal protein S7 [Erythrospermum phytolaccoides] gi|340807221|gb|AEK71808.1| ribosomal protein S7 [Caryocar glabrum] gi|340842502|gb|AEK78161.1| ribosomal protein S7 [Myrtus communis] gi|386268410|gb|AFJ00516.1| ribosomal protein S7 [Francoa sonchifolia] gi|386268423|gb|AFJ00529.1| ribosomal protein S7 [Francoa sonchifolia] gi|403226825|gb|AFR25704.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gi|403226838|gb|AFR25717.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gi|442566198|gb|AGC56397.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gi|442566213|gb|AGC56412.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gi|442566284|gb|AGC56482.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gi|442566299|gb|AGC56497.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gi|442566370|gb|AGC56567.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gi|442566385|gb|AGC56582.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gi|442566456|gb|AGC56652.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gi|442566471|gb|AGC56667.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gi|442566542|gb|AGC56737.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gi|442566557|gb|AGC56752.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gi|442566628|gb|AGC56822.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gi|442566643|gb|AGC56837.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gi|442566714|gb|AGC56907.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gi|442566729|gb|AGC56922.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gi|442566800|gb|AGC56992.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gi|442566815|gb|AGC57007.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gi|442566886|gb|AGC57077.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gi|442566901|gb|AGC57092.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gi|442566972|gb|AGC57162.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gi|442566987|gb|AGC57177.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gi|442567058|gb|AGC57247.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gi|442567073|gb|AGC57262.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gi|442567144|gb|AGC57332.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gi|442567159|gb|AGC57347.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gi|442567230|gb|AGC57417.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gi|442567245|gb|AGC57432.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gi|442567316|gb|AGC57502.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gi|442567331|gb|AGC57517.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gi|442567402|gb|AGC57587.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gi|442567417|gb|AGC57602.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gi|442567488|gb|AGC57672.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gi|442567503|gb|AGC57687.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gi|442567574|gb|AGC57757.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gi|442567589|gb|AGC57772.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gi|442567660|gb|AGC57842.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gi|442567675|gb|AGC57857.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gi|442567746|gb|AGC57927.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus] gi|442567761|gb|AGC57942.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus] gi|442567832|gb|AGC58012.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gi|442567847|gb|AGC58027.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gi|442567918|gb|AGC58097.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gi|442567933|gb|AGC58112.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gi|442568004|gb|AGC58182.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gi|442568019|gb|AGC58197.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gi|442568090|gb|AGC58267.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gi|442568105|gb|AGC58282.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gi|442568176|gb|AGC58352.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gi|442568191|gb|AGC58367.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gi|442568262|gb|AGC58437.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gi|442568277|gb|AGC58452.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gi|442568348|gb|AGC58522.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gi|442568363|gb|AGC58537.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gi|442568434|gb|AGC58607.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gi|442568449|gb|AGC58622.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gi|442568520|gb|AGC58692.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gi|442568535|gb|AGC58707.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gi|442568606|gb|AGC58777.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gi|442568621|gb|AGC58792.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gi|442568692|gb|AGC58862.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gi|442568707|gb|AGC58877.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gi|442568778|gb|AGC58947.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gi|442568793|gb|AGC58962.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gi|442568864|gb|AGC59032.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gi|442568879|gb|AGC59047.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gi|442569036|gb|AGC59202.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gi|442569051|gb|AGC59217.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gi|442569122|gb|AGC59287.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gi|442569137|gb|AGC59302.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gi|442569208|gb|AGC59372.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gi|442569223|gb|AGC59387.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gi|442569294|gb|AGC59457.1| ribosomal protein S7 (chloroplast) [Angophora costata] gi|442569309|gb|AGC59472.1| ribosomal protein S7 (chloroplast) [Angophora costata] gi|442569380|gb|AGC59542.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gi|442569395|gb|AGC59557.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gi|442569466|gb|AGC59627.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gi|442569481|gb|AGC59642.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gi|449326143|gb|AGE92729.1| ribosomal protein S7 [Heliconia collinsiana] gi|449326158|gb|AGE92744.1| ribosomal protein S7 [Heliconia collinsiana] gi|449326924|gb|AGE93501.1| ribosomal protein S7 [Xiphidium caeruleum] gi|449326939|gb|AGE93516.1| ribosomal protein S7 [Xiphidium caeruleum] gi|473964533|gb|EMS51193.1| 30S ribosomal protein S7, chloroplastic [Triticum urartu] gi|525312504|emb|CCW72423.1| rps7 (chloroplast) [Musa acuminata subsp. malaccensis] gi|525312520|emb|CCW72442.1| rps7 (chloroplast) [Musa acuminata subsp. malaccensis] gi|557636958|gb|AHA12560.1| ribosomal protein S7 [Musa textilis] gi|557636972|gb|AHA12574.1| ribosomal protein S7 [Musa textilis] gi|557637460|gb|AHA13056.1| ribosomal protein S7 [Costus pulverulentus] gi|557637474|gb|AHA13070.1| ribosomal protein S7 [Costus pulverulentus] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AFG25696.1| ribosomal protein S7, partial [Iris virginica] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >ref|YP_005296145.1| rps7 gene product (chloroplast) [Pentactina rupicola] gi|377829931|ref|YP_005296158.1| rps7 gene product (chloroplast) [Pentactina rupicola] gi|371532666|gb|AEX31776.1| ribosomal protein S7 (chloroplast) [Pentactina rupicola] gi|371532679|gb|AEX31789.1| ribosomal protein S7 (chloroplast) [Pentactina rupicola] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AEK71881.1| ribosomal protein S7 [Myrothamnus flabellifolia] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >gb|AEK71593.1| ribosomal protein S7 [Terminalia catappa] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60 >ref|YP_004327720.1| ribosomal protein S7 [Hevea brasiliensis] gi|326909450|ref|YP_004327707.1| ribosomal protein S7 [Hevea brasiliensis] gi|308523550|gb|ADO33600.1| ribosomal protein S7 [Hevea brasiliensis] gi|308523564|gb|ADO33614.1| ribosomal protein S7 [Hevea brasiliensis] Length = 155 Score = 93.6 bits (231), Expect(2) = 6e-21 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 182 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRGHEKDSTK 24 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR +K K Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQK 53 Score = 33.1 bits (74), Expect(2) = 6e-21 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 46 AMKKIQQKTETNPLS 2 AMKKIQQKTETNPLS Sbjct: 46 AMKKIQQKTETNPLS 60