BLASTX nr result
ID: Jatropha_contig00000608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000608 (485 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510740.1| conserved hypothetical protein [Ricinus comm... 47 4e-11 >ref|XP_002510740.1| conserved hypothetical protein [Ricinus communis] gi|223551441|gb|EEF52927.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 47.0 bits (110), Expect(2) = 4e-11 Identities = 30/58 (51%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +3 Query: 183 MEDTEFQEGDIFRLVNFDDLEQLDWDNLFTGLPDGLPSLPTK-SPPPIDVFNSSPDSV 353 MEDT+ DI VNFD L Q+DWDNLF D P L T+ S P + +SSPDSV Sbjct: 1 MEDTD----DILESVNFDSLGQIDWDNLF---DDNSPLLVTESSSSPENFSDSSPDSV 51 Score = 46.2 bits (108), Expect(2) = 4e-11 Identities = 24/37 (64%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +1 Query: 361 WIGQLENVLMEDDDDWA-AEPSLPISENFFADILVDS 468 WI Q+EN+LM+DDD A AEPS SE F AD+LVDS Sbjct: 54 WIDQVENMLMKDDDVLASAEPSQHFSEGFLADLLVDS 90