BLASTX nr result
ID: Jatropha_contig00000528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000528 (451 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21459.3| unnamed protein product [Vitis vinifera] 64 3e-08 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 57 2e-06 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -1 Query: 109 RAIRTRTVDFLGKTDQTDYYQNDSNFFKDPTAFF 8 RAIRTRTVD LGKTDQTDYYQND N FKDPT F Sbjct: 38 RAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIF 71 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 100 RTRTVDFLGKTDQTDYYQNDSNFFKDPTAFF 8 R RTVD LGKTDQTDYY+NDSN FKDPT F Sbjct: 10 RIRTVDLLGKTDQTDYYRNDSNCFKDPTCIF 40